SecReT6
Protein ID: 116249131
SecReT6 ID147
T6SS typei5
Gene symbolimpJ
Locus tagpRL120466
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]503601..504941 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ1M3Z8
KEGG IDrle:pRL120466
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-152, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|116249131|ref|YP_764972.1| hypothetical protein pRL120466 [Rhizobium leguminosarum bv. viciae 3841]
MRNENRVAWSEGMFLRVQHFQQADRWTERLVRTATHGLSPYPWGVAEIGIDRGALAIGQFALSNLRGVLP
DGTPFEAPVDTDLPPPLDLDENTKNAVVYLALPARQPGKADVALNGGAARNSVRLVASPYEAPDANVETD
FMAPIDVGRLSLRYLRTGDELAGYELIGLARIIEVRSDRAVILDPDYIVPSLNCTAAARLGELITELLGI
VRHRAEAIAERIGDPTIRGTAEVGDYLLLQMLNRADPMLKHISANATRIHPIVFYETCIQLAGELATFTT
DRKRASDFPPYRHDDLKATFAAVFDDLRASLSSVLEQAAVAIELAERRHGVRIGTINDRSLLRDAGFVLA
VRAEMPAEDVRRKLPAQIKIGPVERIADLVNVALPGIPVRPLPVLPRQLPYRSGTIYFELDTKNPLWKQL
DTSGAIAVHLAGDFPGLEIELWALRE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c504941-503601 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGAGGAATGAAAACCGGGTGGCCTGGAGCGAAGGCATGTTCCTTCGCGTGCAGCATTTTCAGCAGGCGG
ACCGCTGGACCGAGCGGCTCGTGCGCACGGCGACGCACGGCCTGTCGCCCTATCCCTGGGGAGTGGCGGA
AATCGGCATCGACCGCGGCGCACTGGCGATCGGCCAATTCGCGCTGTCGAACCTGCGCGGCGTATTGCCG
GACGGAACGCCGTTCGAAGCCCCTGTTGATACCGACCTGCCGCCGCCGCTCGATCTCGACGAGAACACCA
AGAATGCGGTCGTCTATCTCGCACTTCCCGCCCGTCAGCCGGGCAAGGCCGATGTGGCGTTGAACGGCGG
TGCCGCGCGCAACAGCGTCCGGCTCGTCGCGTCGCCCTATGAAGCGCCGGATGCCAATGTCGAGACCGAC
TTCATGGCGCCGATCGATGTCGGCCGTCTCAGCCTGCGCTATCTGAGGACCGGTGATGAACTCGCCGGCT
ACGAACTCATCGGACTTGCCCGTATCATCGAGGTGCGTTCCGACAGGGCCGTGATCCTCGATCCGGACTA
TATTGTGCCGAGCCTCAACTGTACGGCTGCTGCACGGCTCGGCGAGCTGATCACCGAACTGCTCGGCATC
GTGCGCCACCGCGCGGAGGCCATCGCCGAACGGATCGGCGATCCCACCATTCGAGGGACCGCGGAGGTCG
GCGACTACCTGCTCTTACAGATGCTCAACCGCGCGGATCCGATGCTGAAACACATTTCGGCGAATGCGAC
GCGGATCCACCCCATCGTCTTTTACGAGACCTGCATCCAGCTTGCCGGCGAGCTCGCCACCTTCACGACC
GACCGCAAGCGCGCGAGCGACTTCCCGCCTTACCGCCACGACGACCTGAAGGCGACGTTCGCGGCCGTCT
TCGACGATCTGCGCGCCTCGCTGTCATCAGTGCTCGAACAGGCAGCCGTGGCGATCGAGTTGGCCGAACG
CCGGCATGGCGTCAGGATCGGTACGATCAACGACCGTTCGCTGCTGAGAGATGCCGGCTTCGTACTGGCG
GTCCGGGCCGAGATGCCGGCCGAAGACGTGCGCCGCAAGCTGCCGGCGCAGATCAAGATCGGCCCGGTTG
AGCGCATCGCCGACCTCGTCAACGTCGCGCTGCCGGGCATCCCCGTCCGGCCGCTGCCGGTGCTGCCACG
CCAGCTCCCCTATCGCTCCGGCACCATCTATTTCGAACTCGACACCAAGAACCCGCTTTGGAAACAACTC
GACACTTCGGGCGCCATCGCCGTGCATCTCGCCGGCGATTTTCCCGGGCTCGAAATAGAACTGTGGGCCC
TTAGAGAATGA