SecReT6
Protein ID: 116249132
SecReT6 ID147
T6SS typei5
Gene symbolimpI
Locus tagpRL120467
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]504931..506130 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ1M3Z7
KEGG IDrle:pRL120467
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.50E-14, Aligned region: 29..95
Protein Sequence: 399 a.a.     [Download]
>gi|116249132|ref|YP_764973.1| FHA domain-containing protein [Rhizobium leguminosarum bv. viciae 3841]
MRLELKEITRDAAAPAGQSKWFFERGRRTLGRAPDCDWRLPEDRRSVSKLHCIIERDREGFLLRDQSANG
SRVDGVAVHEGQIVRLADRSRLELGGLAFSVHISGEKDREIEDPDAGLMLSDEPLTISAILADIAPGGHT
ANGILGERAVDDWGLPEKAGKKGAASSRNVEIGWSGPPEIRSVTQLLPEDWNSEETEYGSHLEHGSATHV
SAPITQRRPAPVIEIVSDNDPQAEPEAEEFPALTIGRPEAFADRLEPLLARLEEAVQNSYAVFEINAPSA
ASEPVFLAASSREEALFARTETLLGQQLKLNSALEALVQTAGRLEPRMLEARVETGAWRLPWGRDRAYWR
AYRAQFEQDGRSRSIHDVFRDAMTGAVNGTQAGPRPQDGQEGKDAHHEE
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c506130-504931 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGCGGCTTGAACTGAAAGAGATCACCAGGGACGCGGCGGCGCCAGCAGGCCAGTCAAAATGGTTCTTCG
AACGCGGCCGGCGAACGCTCGGCCGGGCACCGGATTGCGACTGGCGCCTGCCGGAGGATCGGCGCTCCGT
TTCGAAGCTCCATTGCATCATCGAGCGCGACCGCGAAGGCTTCCTGCTGCGCGACCAGAGCGCAAACGGC
TCCCGGGTCGACGGCGTCGCCGTCCATGAGGGCCAGATCGTGCGGCTTGCCGACAGGTCGCGGCTGGAGT
TAGGCGGACTTGCCTTTTCCGTCCACATATCGGGCGAGAAAGACCGCGAGATAGAGGACCCCGATGCCGG
TCTCATGCTGAGTGACGAACCGCTGACCATCTCCGCAATCCTGGCCGATATCGCTCCGGGCGGTCATACC
GCAAACGGCATCCTTGGCGAGCGTGCGGTCGATGATTGGGGCCTTCCCGAAAAGGCCGGGAAAAAGGGAG
CGGCCTCATCCCGCAATGTCGAGATCGGCTGGAGCGGCCCTCCGGAGATCCGCTCAGTCACCCAGCTTCT
GCCGGAGGATTGGAATTCGGAAGAAACCGAATATGGCAGCCACCTGGAACATGGCTCCGCCACCCATGTT
TCGGCGCCCATCACTCAGCGCCGGCCGGCCCCGGTGATCGAGATCGTCAGCGACAACGATCCGCAGGCAG
AGCCGGAGGCCGAGGAGTTTCCGGCACTGACGATCGGCCGGCCCGAAGCCTTCGCCGATCGCCTGGAGCC
ACTGCTTGCCCGGCTCGAGGAGGCTGTCCAGAATAGCTATGCCGTTTTCGAGATCAATGCGCCATCCGCC
GCCAGCGAGCCGGTTTTCCTTGCCGCCAGCAGCAGGGAGGAAGCGCTTTTTGCCCGCACCGAAACCCTGC
TCGGGCAACAGCTCAAGCTCAATTCGGCGCTTGAGGCTCTGGTTCAGACAGCGGGCCGGCTGGAGCCGCG
CATGCTTGAGGCGCGGGTCGAGACCGGCGCCTGGCGCCTGCCCTGGGGCCGAGACCGGGCCTATTGGCGC
GCCTACCGGGCACAATTCGAACAGGACGGCAGGAGCCGGTCGATCCATGACGTTTTCCGCGACGCAATGA
CGGGGGCGGTAAACGGCACGCAGGCAGGGCCTCGTCCGCAAGACGGGCAGGAAGGAAAAGACGCGCATCA
TGAGGAATGA