SecReT6
Protein ID: 116249133
SecReT6 ID147
T6SS typei5
Gene symbolimpH
Locus tagpRL120468
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]506142..507143 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ1M3Z6
KEGG IDrle:pRL120468
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.50E-70, Aligned region: 33..310
Protein Sequence: 333 a.a.     [Download]
>gi|116249133|ref|YP_764974.1| hypothetical protein pRL120468 [Rhizobium leguminosarum bv. viciae 3841]
MDLPTARKPDALADLLERDPGRFEPVTAFRVAQASVREGRLDVASHVGVSPAPLAVSGYKRKGGSATVRS
ALAGLVGALGSMPSAYNDLVMREERNRSRALAGFFDMFGARMAELFTDACEKYRIARRLRWGGAWANNAF
VTTLLSLTGFGTKRLVEKSGVDEELILRFSGFFAARNRNAVNLRAMLCEFSGLPVEIELFRGRWLTIPIE
ERSRIGQPQGVQLGVNATAGAAIHDFSGGFRIVIGPLGYADYLSLAPGGRAITELFALARLYVGAALEFD
IQAILKKEDVPFCQLGQAGDPPRLGWNSWARVAPAASDSGDAVIVERLSVQAR
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c507143-506142 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGGATCTCCCGACCGCCCGCAAGCCAGACGCCCTTGCCGATCTGCTCGAACGCGACCCCGGCCGCTTCG
AGCCGGTGACGGCCTTTCGCGTCGCGCAGGCTTCGGTGAGGGAAGGACGGCTTGATGTCGCCTCGCATGT
CGGCGTCTCGCCGGCGCCTCTTGCCGTCAGCGGATATAAGCGCAAGGGCGGCAGTGCCACCGTCCGCAGC
GCGCTTGCCGGTCTCGTCGGGGCGCTCGGCTCGATGCCGTCGGCCTATAACGACCTCGTCATGCGCGAGG
AGCGCAACAGGTCGCGGGCGCTGGCGGGCTTCTTCGACATGTTCGGCGCGCGGATGGCGGAACTCTTCAC
TGACGCCTGCGAGAAATATCGTATCGCCAGGCGGCTGCGATGGGGCGGCGCATGGGCAAACAACGCCTTC
GTCACCACGCTCCTGTCACTCACCGGCTTCGGCACCAAACGTCTCGTCGAAAAGAGCGGCGTCGACGAGG
AACTGATCCTGCGTTTCTCGGGCTTCTTTGCCGCGCGCAACCGCAATGCCGTCAATCTCCGCGCCATGCT
CTGCGAATTCAGTGGCCTGCCGGTGGAGATCGAATTGTTCCGCGGCCGCTGGCTTACCATCCCGATCGAG
GAGCGCAGCCGCATCGGCCAGCCCCAGGGCGTCCAGCTTGGCGTCAATGCGACGGCAGGTGCTGCGATCC
ACGATTTCAGCGGCGGCTTTCGCATCGTCATCGGTCCGCTCGGTTATGCCGACTACCTCTCGCTCGCGCC
GGGCGGCCGCGCCATCACCGAACTCTTCGCCCTGGCGCGGCTCTATGTCGGTGCGGCGCTCGAATTCGAC
ATACAGGCGATCCTGAAGAAGGAGGACGTTCCCTTCTGCCAGCTCGGACAGGCGGGCGATCCGCCGCGGC
TTGGCTGGAACAGTTGGGCGAGGGTTGCGCCGGCTGCAAGCGACAGCGGCGATGCAGTGATCGTCGAGCG
CCTGTCGGTTCAGGCGCGGTGA