SecReT6
Protein ID: 116249134
SecReT6 ID147
T6SS typei5
Gene symbolimpG
Locus tagpRL120469
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]507164..508945 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ1M3Z5
KEGG IDrle:pRL120469
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.60E-192, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|116249134|ref|YP_764975.1| hypothetical protein pRL120469 [Rhizobium leguminosarum bv. viciae 3841]
MAEGFLHRYNEELLALRRRAARFADAFPKIAGRLRMTGDVADDPHVERLIQSFAYSAARVRQKLDDEFPE
LTDGLLETLYPHYLAPLPSMSIVKFRPSDTLASVQTVPRHTEILAEPVRGEACRFRTTQDVEIAPIEITG
ANLSGQPINAPLSPYTGVAGCLRLSIRSLDARKPLGGLGMSRLRLHIPSPWQQAVAIYELLANHTLGIAL
AKHADDRSPVFLPAGNLKPVGFEPEEAMLPYPAPSFIGYRLLTEFFALPRKFLFLDIEGFDAWRGETLEL
FVYLGESDAKLERAVSVRDFALNATPVVNLFRQVCEPIAIDGTCTEYRLLPDARRQKTREIYSIDRVLLT
GSRGQEEFCQPFFGRSQRAGTSATYWQAYRRFDEDDRTSDMDIAFVNRQRRSSGPVDAVASVDTLCLNRD
LPEQLPFGGGHPFLQLASGHEAIASVEALIPPTPSVRMNDQEGRNWRLMSHLILNHLSLFDNDGAALKDI
LSLYAFRDSPETKQFVDALVRIKAGTSTARLGSGGTVPGTEIALEFDPAAIDRPSAFLFGSVLDRFFSLY
ASVNSFTRLTIRMKGQSRPIARWPARAAERPLL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c508945-507164 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGGCTGAAGGTTTCCTGCACCGTTACAATGAGGAATTGCTGGCGCTCCGCCGCCGGGCCGCGCGCTTTG
CCGATGCCTTCCCGAAGATCGCCGGCCGCCTGCGCATGACCGGCGACGTCGCCGACGACCCGCATGTGGA
ACGCCTGATCCAGAGTTTCGCCTATTCGGCCGCCCGCGTCCGTCAGAAGCTGGACGACGAGTTTCCCGAA
CTGACCGACGGCCTTCTCGAAACGCTCTATCCCCATTATCTGGCGCCGCTGCCCTCGATGAGCATCGTCA
AGTTCCGCCCGAGCGACACGCTCGCCTCGGTCCAGACCGTGCCGCGCCATACGGAAATCCTAGCCGAGCC
GGTGAGAGGCGAAGCTTGCCGCTTCCGCACCACGCAGGATGTCGAGATCGCGCCGATCGAAATCACCGGT
GCTAATCTCTCCGGCCAGCCGATCAATGCGCCGCTTTCGCCCTATACCGGCGTTGCCGGTTGCCTCAGGC
TGTCCATCCGCAGCCTCGATGCCCGAAAGCCGCTCGGCGGCCTTGGCATGAGCCGGCTGCGCCTGCACAT
TCCGTCCCCCTGGCAGCAGGCAGTGGCGATCTACGAACTGCTTGCCAATCATACACTCGGCATCGCACTT
GCCAAACATGCGGACGACCGTTCGCCGGTCTTCCTGCCGGCGGGCAATCTCAAACCGGTCGGCTTCGAAC
CAGAAGAGGCCATGCTGCCCTATCCGGCGCCGAGCTTCATCGGCTACCGGCTGCTAACCGAATTTTTCGC
TCTGCCGCGCAAATTTCTCTTTCTCGACATCGAAGGGTTCGATGCGTGGCGGGGGGAGACGCTGGAGCTC
TTCGTCTACCTCGGGGAAAGCGACGCCAAGCTCGAACGCGCAGTCTCGGTCCGCGACTTCGCGCTCAATG
CAACGCCCGTCGTCAACCTCTTCCGCCAGGTTTGCGAGCCGATCGCCATCGACGGCACCTGCACGGAATA
CCGCCTCCTGCCGGATGCGCGCCGCCAAAAGACCCGCGAGATCTATTCCATCGACCGCGTTCTCCTGACC
GGATCGCGCGGCCAGGAGGAATTCTGCCAGCCGTTCTTCGGACGGTCGCAACGGGCTGGCACGAGCGCAA
CCTACTGGCAGGCCTATCGCCGTTTCGACGAAGACGACAGGACCAGCGACATGGACATCGCCTTCGTCAA
CAGGCAGCGCCGTTCTTCAGGTCCTGTCGATGCGGTCGCAAGCGTCGATACGCTCTGCCTCAACCGCGAC
CTGCCGGAACAGCTTCCCTTCGGCGGCGGCCATCCATTCCTGCAGCTCGCTTCCGGCCATGAGGCGATCG
CCAGCGTCGAAGCCCTGATCCCGCCGACGCCGTCGGTCAGGATGAACGATCAGGAAGGGCGGAACTGGCG
GCTGATGTCGCATCTCATCCTCAATCACCTGTCGCTCTTCGACAATGACGGTGCGGCACTCAAGGATATC
CTGTCGCTCTACGCCTTCCGGGATAGCCCCGAGACCAAGCAATTCGTCGATGCGCTCGTCAGGATCAAGG
CGGGCACTTCGACCGCCCGCCTCGGCAGCGGCGGCACGGTGCCCGGCACCGAGATCGCGCTTGAATTCGA
TCCGGCCGCCATCGACCGGCCCTCGGCCTTCCTGTTCGGCAGCGTGCTCGACCGCTTCTTCAGTCTCTAC
GCCTCGGTCAACAGCTTCACCCGGCTCACCATTCGGATGAAGGGGCAATCGAGGCCGATCGCCCGGTGGC
CGGCACGCGCCGCCGAACGCCCGCTTCTCTAA