SecReT6
Protein ID: 116249135
SecReT6 ID147
T6SS typei5
Gene symbolimpF
Locus tagpRL120470
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]508938..509447 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ1M3Z4
KEGG IDrle:pRL120470
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.60E-18, Aligned region: 43..143
Protein Sequence: 169 a.a.     [Download]
>gi|116249135|ref|YP_764976.1| hypothetical protein pRL120470 [Rhizobium leguminosarum bv. viciae 3841]
MVDPLERYRLRDRVLARSILDRLIDEAPDRTVDPPISFVDQVRDVREAIRRDLEALLNTRRCPATPPAAL
SELKDALVSYGVDGIVSANLMTDQAKLKLAQAIERRIALFETRLSDVRVTILKSRTMTERALRMRIQATF
SLHEGMPPISFESTIDPSTQRFLVEAAHG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c509447-508938 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGGTTGACCCCCTCGAACGCTACCGGCTGCGCGACCGCGTCCTTGCCCGCTCGATCCTCGACAGGTTGA
TCGACGAGGCTCCGGATCGCACCGTCGATCCGCCGATAAGCTTCGTCGACCAGGTGCGCGACGTCAGGGA
GGCGATCCGCCGCGATCTCGAAGCGCTGCTCAATACGCGGCGCTGCCCGGCCACACCACCGGCGGCACTT
TCCGAACTCAAGGACGCGCTGGTGAGCTATGGCGTCGACGGCATCGTCTCGGCAAATCTGATGACCGACC
AGGCCAAGCTCAAGCTGGCGCAAGCGATCGAGAGGCGGATTGCGCTTTTCGAAACGCGGCTGTCCGATGT
GCGGGTGACGATCCTCAAGAGCCGGACGATGACCGAACGGGCGCTGCGCATGCGCATCCAGGCGACCTTC
AGCCTGCATGAAGGCATGCCGCCGATCAGCTTTGAGTCGACGATCGATCCCTCGACCCAGCGCTTCCTCG
TGGAGGCGGCGCATGGCTGA