SecReT6
Protein ID: 116249136
SecReT6 ID147
T6SS typei5
Gene symbolimpE
Locus tagpRL120471
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]509440..510270 [-]
Productputative virulence-island/protein involved in nitrogen fixation
NoteTagJ
UniProt IDQ1M3Z3
KEGG IDrle:pRL120471
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.20E-36, Aligned region: 141..262
TPR_19 [PF14559], Evalue: 3.70E-05, Aligned region: 12..66
TPR_19 [PF14559], Evalue: 3.70E-05, Aligned region: 116..132
TPR_16 [PF13432], Evalue: 0.0035, Aligned region: 12..66
TPR_16 [PF13432], Evalue: 0.0035, Aligned region: 118..149
TPR_14 [PF13428], Evalue: 0.0057, Aligned region: 15..43
TPR_14 [PF13428], Evalue: 0.0057, Aligned region: 35..68
TPR_14 [PF13428], Evalue: 0.0057, Aligned region: 114..144
Protein Sequence: 276 a.a.     [Download]
>gi|116249136|ref|YP_764977.1| putative virulence-island/protein involved in nitrogen fixation [Rhizobium leguminosarum bv. viciae 3841]
MTLSASIAQSLSDNALDDAIEEVKAHLKVKPSDQEARHLYIDLLVLAGDYQRADNQCSLAATLSPDATMG
FALLRNELRAMAARDAWFTSGALPEFPQGPSELDKLAVRLGIAHRDDNPDEARTTLDALEKLRGERPLIW
NGRAVSDFRDLDDRTPHALEVIMTGGGYLWIDFSKIAALTIEPIARPRDLAFRRAELSLIDGAAASVLLP
AVYHGTGKDAALRLGRETEWIEEPTGITSGRGQRCYLAGDEMVSFHDTQSLEIVPATAAGRQVAHG
 
Nucleotide Sequence: 831 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c510270-509440 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGACGCTTTCCGCCAGCATCGCCCAATCGCTCAGCGACAATGCCCTCGATGACGCGATCGAGGAGGTCA
AGGCGCATCTGAAGGTCAAGCCCTCGGATCAGGAGGCGCGGCATCTCTATATCGATCTTCTCGTGCTTGC
CGGCGATTACCAGCGGGCGGACAATCAGTGCAGCCTTGCTGCCACCCTCTCACCCGACGCGACGATGGGT
TTCGCCTTGCTGCGCAACGAGCTTCGGGCGATGGCGGCGCGCGACGCCTGGTTTACGAGCGGCGCCCTGC
CGGAATTTCCGCAGGGGCCGAGCGAGCTCGACAAGCTCGCCGTCCGCCTCGGTATCGCCCATCGCGACGA
CAATCCGGATGAGGCGAGGACGACGCTCGATGCGCTCGAGAAGCTGAGGGGCGAACGTCCGCTGATCTGG
AACGGCAGGGCCGTCTCCGATTTCCGCGATCTCGACGACCGGACACCGCATGCCCTGGAAGTTATCATGA
CCGGCGGCGGCTATCTCTGGATCGATTTTTCCAAGATCGCAGCCCTCACGATAGAGCCGATTGCCCGTCC
GCGCGATCTGGCCTTCCGCCGCGCCGAGCTTTCCCTGATCGACGGCGCGGCCGCGTCGGTGCTTCTGCCG
GCGGTTTATCATGGCACCGGCAAGGATGCGGCGCTCAGGCTCGGCCGCGAGACCGAGTGGATCGAGGAGC
CGACCGGCATCACCAGCGGCCGCGGCCAGCGCTGCTACCTCGCCGGCGACGAAATGGTTTCCTTCCATGA
CACCCAAAGTCTGGAGATCGTGCCGGCAACGGCTGCCGGCAGGCAGGTCGCGCATGGTTGA