SecReT6
Protein ID: 116249137
SecReT6 ID147
T6SS typei5
Gene symbolimpD
Locus tagpRL120472
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]510267..511655 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ1M3Z2
KEGG IDrle:pRL120472
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.30E-152, Aligned region: 12..443
Protein Sequence: 462 a.a.     [Download]
>gi|116249137|ref|YP_764978.1| hypothetical protein pRL120472 [Rhizobium leguminosarum bv. viciae 3841]
MGSSTEWRRRADQLITLIDEALNKQVNAILHHPDFQAMEARWRGLAMLVREASRSGEVKVKLLGVSWSEL
TRSMERASDFDQSHLFELIYSREFGMPGGEPLGLLVGDYYLSPADPAGGDPVSTLSQIGMVAAAAFCPFV
AGAAPLAIGLEDFHELNRVNDFSWLANETARIRWNGLRAREDSRFLGLVAPRILMRSPLTPHSRNRNDGF
PFRESIAGDGSSLLWGNAAFAFATVVIRNFIDSGWFADIRGVTQDAVDGGLLSTAELPPYDFGTESNGLS
AQAPVEIHLTSGQEQQLCELGIIPAATTYLSSSAIFNSNQSLHAPPHYSNEHARQNARLAAMLQYVLCAS
RFSHYLKVIMRDEIGQLSDAISIERKLADWLTAYTLGNDDADIALRTRFPLRSAGIGVAEIPGKPGSFSC
TVRLQPHFQLDDVATSFHLIAETATTGQILSRPVAIPERMSA
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c511655-510267 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGGGTTCCAGCACTGAATGGCGGCGCCGGGCGGATCAGCTGATTACGCTGATCGACGAAGCGCTGAACA
AGCAAGTCAATGCCATCCTCCACCATCCCGATTTTCAGGCGATGGAGGCGAGATGGCGTGGCCTCGCCAT
GCTCGTGCGCGAGGCAAGCCGCAGCGGCGAAGTGAAAGTCAAGCTTCTCGGCGTCAGCTGGAGCGAGCTC
ACGCGGAGCATGGAGCGTGCCAGCGACTTCGACCAAAGCCACCTCTTCGAACTCATCTATAGCCGCGAGT
TCGGCATGCCGGGCGGCGAACCCCTCGGTCTGCTGGTCGGCGATTATTATCTTTCTCCGGCCGATCCGGC
CGGCGGCGATCCGGTCAGCACGCTGTCGCAGATCGGCATGGTGGCGGCCGCCGCCTTCTGCCCCTTCGTC
GCGGGTGCTGCGCCGCTGGCGATCGGGCTTGAAGACTTTCACGAGCTGAACCGGGTCAACGACTTTTCCT
GGCTTGCCAATGAGACCGCCCGCATCCGCTGGAATGGTCTCCGCGCACGTGAGGATTCGCGTTTCCTCGG
ACTTGTCGCGCCGCGCATCCTGATGCGCTCGCCGCTGACGCCTCATTCGCGCAATCGCAACGACGGCTTT
CCCTTCCGCGAAAGCATTGCTGGCGACGGTAGTTCGCTTCTCTGGGGCAACGCCGCTTTCGCCTTTGCGA
CCGTCGTCATTCGCAATTTCATCGATTCCGGCTGGTTCGCGGATATCCGCGGCGTCACGCAGGATGCCGT
CGACGGTGGCCTGCTGAGTACAGCGGAATTGCCGCCTTATGACTTCGGCACAGAAAGCAACGGACTATCA
GCCCAGGCGCCGGTGGAGATCCATCTGACCAGCGGCCAGGAGCAGCAGCTCTGCGAGCTCGGCATCATCC
CCGCCGCGACCACCTATCTCTCCTCTTCGGCGATTTTCAATTCCAATCAGTCCCTGCATGCGCCGCCGCA
CTATTCCAACGAGCATGCGCGCCAGAACGCCCGCCTCGCCGCGATGCTGCAATATGTGCTCTGCGCGTCG
CGCTTCTCGCATTATCTCAAAGTCATCATGCGCGACGAGATCGGCCAGCTTTCGGATGCGATCTCGATCG
AGCGGAAGCTGGCGGACTGGCTGACCGCCTATACGCTCGGCAACGACGACGCCGACATCGCGCTACGCAC
CCGCTTTCCCCTGCGCTCGGCCGGCATCGGCGTCGCAGAGATTCCGGGCAAGCCCGGCAGCTTCTCCTGT
ACCGTCCGGCTGCAGCCGCATTTCCAGCTCGACGACGTTGCCACGAGCTTCCATCTCATCGCTGAGACCG
CGACCACGGGCCAGATTTTGAGCCGCCCAGTTGCCATACCCGAGAGGATGTCCGCATGA

Protein ID: 116249138
SecReT6 ID147
T6SS typei5
Gene symbolimpC
Locus tagpRL120473
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]511731..513212 [-]
Productputative virulence-island/protein involved in nitrogen fixation
NoteTssC
UniProt IDQ1M3Z1
KEGG IDrle:pRL120473
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-191, Aligned region: 64..490
Protein Sequence: 493 a.a.     [Download]
>gi|116249138|ref|YP_764979.1| putative virulence-island/protein involved in nitrogen fixation [Rhizobium leguminosarum bv. viciae 3841]
MTAETQLQTKEDVGFAPDENLLSKVVAATRQTEPDRAQDLLRTLTDQALKGTVTYDRNLTITLNNAIAEI
DKAISSQLAAIMQSPEFTKLEGAWRGLNYLVKNSETSANLKIRVLNASKRDVAKDLAKAVEFDQSRLFKS
VYEDEFGTPGGEPMGALIGDFEFDNSFDDVQLLQGVSMIAAAAFAPFISAASPRMFGFEDFRELAKPRDL
EKIFETVEYAKWRSLRDSDDSRFVTLAMPRVLARMPYGPKTSPIEEFNFDETGGSKTGELSHGSYCWMNA
AYVMGTRLTEAFAKNGWCTAIRGAENGGKVEGLPMHIFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLP
LCHYKNTDYAVFFGAQTAHKPKLYDRPEATANAAVSARLPYMMATSRFAHYLKVMGRDKIGSFMEAEDCE
AWLNRWISNYVNANDDAGEESRAKYPLREAKVTVQEIPGRPGAYNAVAWMRPWLQMEELTTSLRMVARIP
SKN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c513212-511731 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGACCGCCGAAACGCAATTGCAAACAAAGGAAGACGTAGGCTTCGCGCCTGATGAGAACCTGCTCTCGA
AGGTCGTTGCGGCAACCCGCCAGACCGAGCCCGACCGTGCCCAGGACCTTCTGCGCACCCTTACCGATCA
AGCCCTGAAGGGCACCGTCACCTATGATCGCAACCTGACGATCACCTTGAACAATGCCATTGCCGAAATC
GATAAGGCGATATCAAGCCAGCTCGCGGCCATCATGCAATCGCCTGAGTTCACCAAGCTCGAAGGCGCCT
GGCGCGGCCTGAACTATCTCGTCAAGAACAGCGAGACCAGCGCCAACCTGAAGATCCGCGTCCTCAATGC
ATCCAAGCGCGATGTCGCCAAGGATCTGGCAAAGGCCGTCGAATTCGACCAGTCGCGGCTTTTCAAGTCG
GTCTATGAAGACGAATTCGGCACGCCGGGCGGCGAACCGATGGGCGCGCTGATCGGCGATTTCGAATTCG
ACAATTCCTTCGACGACGTCCAGCTGCTGCAGGGCGTCTCGATGATCGCCGCAGCCGCTTTCGCCCCGTT
CATCTCCGCCGCCAGCCCGCGCATGTTCGGCTTCGAGGATTTCCGGGAGCTCGCAAAACCCCGCGATCTC
GAGAAGATCTTCGAGACGGTTGAATACGCCAAGTGGCGCAGCCTGCGTGACAGCGATGATTCCCGCTTCG
TGACGCTCGCCATGCCGCGTGTGCTCGCCCGCATGCCCTATGGCCCGAAGACCAGCCCGATCGAGGAGTT
CAACTTCGACGAAACCGGCGGCTCCAAGACCGGCGAACTGTCTCACGGTTCCTACTGCTGGATGAACGCA
GCCTATGTGATGGGTACGCGTCTCACCGAGGCCTTCGCCAAGAACGGCTGGTGCACCGCCATTCGCGGGG
CGGAAAACGGCGGCAAGGTCGAAGGGCTGCCGATGCACATCTTCTCGAGCGACGACGGCGATCTGGACCT
GAAGTGCCCGACGGAAGTCGGTATCACCGATCGCCGCGATGCCGAACTCGGCAAGCTCGGCTTCCTGCCG
CTTTGCCACTACAAGAACACGGACTATGCCGTGTTCTTCGGGGCGCAGACCGCGCACAAGCCGAAGCTCT
ACGACCGGCCCGAGGCGACTGCGAATGCGGCCGTTTCAGCCCGCCTGCCCTATATGATGGCGACCTCGCG
CTTCGCCCATTATCTCAAGGTCATGGGCCGCGATAAGATCGGCTCCTTCATGGAAGCGGAAGATTGCGAG
GCCTGGCTCAATCGCTGGATCTCCAACTATGTCAACGCCAATGACGACGCCGGCGAAGAGTCGCGAGCGA
AATATCCGCTGCGCGAGGCAAAAGTCACCGTACAGGAAATCCCCGGCAGGCCGGGCGCCTACAACGCCGT
GGCCTGGATGCGCCCGTGGCTGCAGATGGAGGAATTGACCACCTCGCTGCGCATGGTCGCCCGGATTCCC
TCGAAGAACTGA