SecReT6
Protein ID: 116249139
SecReT6 ID147
T6SS typei5
Gene symbolimpB
Locus tagpRL120474
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]513343..513888 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ1M3Z0
KEGG IDrle:pRL120474
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.20E-60, Aligned region: 15..169
Protein Sequence: 181 a.a.     [Download]
>gi|116249139|ref|YP_764980.1| hypothetical protein pRL120474 [Rhizobium leguminosarum bv. viciae 3841]
MRRRRISMASVHEKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPTQQLKPFGERKFVQVD
RDNFDDVMRRMTPGLTLSVENTLEKNGTELPVSLKFESMADFEPGAVVDQVPALKALLNARNQLRDLMSK
ADRSEELERLLEDILQNKADLSQLVAQLGGDKAEEAKDALN
 
Nucleotide Sequence: 546 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c513888-513343 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGAGACGAAGAAGAATCTCGATGGCAAGTGTGCATGAGAAACTGGAACGGGTTCGCAAACCGCGAGTCC
ACATCAAATACGAAGTGGAAACCGAAGGCGCGATGGTGGTGAAGGAACTGCCCTTCGTCGTCGGCGTACT
CGGCGACTTCTCCGGAAATCCCACGCAGCAGCTCAAGCCTTTCGGCGAGCGCAAGTTCGTGCAGGTCGAC
CGCGACAACTTCGACGACGTCATGCGCCGCATGACGCCGGGCCTCACCCTGTCGGTCGAGAACACTCTCG
AGAAGAACGGAACAGAGCTTCCCGTTTCGCTGAAATTCGAAAGCATGGCCGATTTCGAACCCGGCGCGGT
CGTCGATCAGGTGCCGGCGCTGAAGGCCCTGCTCAACGCGCGCAACCAGCTGCGCGACCTGATGAGCAAG
GCGGACCGCTCCGAAGAGCTCGAGCGCCTGCTCGAGGATATCCTGCAGAACAAGGCCGATCTCTCGCAGC
TGGTGGCCCAGCTTGGCGGCGACAAAGCCGAAGAGGCGAAGGACGCATTGAACTGA