SecReT6
Protein ID: 116249140
SecReT6 ID147
T6SS typei5
Gene symbolimpA
Locus tagpRL120475
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]513925..514917 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ1M3Y9
KEGG IDrle:pRL120475
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-17, Aligned region: 31..88
ImpA-rel_N [PF06812], Evalue: 3.90E-17, Aligned region: 157..177
Protein Sequence: 330 a.a.     [Download]
>gi|116249140|ref|YP_764981.1| hypothetical protein pRL120475 [Rhizobium leguminosarum bv. viciae 3841]
MYYRIKDARNAARTAERSIIPGETITIAPAWHDVSNLGLQILSSKSKDIEVLAWLAEAQLRLRGFSGLHD
VYVATVSLLDKHFDALHSIGDGDVEERFAPFAGLNGVGGEGTLIQAIRLTSLIPGGKFAQFSLWDFQLSQ
RPNETERRKELQQAAAEAGVAQMSAYLDVLTGCIAAFDRMVEILDEHCGDQAPPSSNTRNVLQEAASAIR
MLAGIEAPTEAPLAAPQALASQGSEPLRAVETDESEAIGLRPVSAEMIRSREEAFELLIAVARYFRRTEP
HSPISMSIETLVRRGRMDFFELLAELLPEQQTRNAVLTAAGIQPVADKGG
 
Nucleotide Sequence: 993 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c514917-513925 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATATACTATAGAATTAAGGACGCGAGAAACGCCGCGCGTACAGCCGAACGTAGTATTATCCCGGGTGAGA
CTATTACGATTGCACCTGCTTGGCACGATGTTAGCAATCTTGGATTGCAGATCCTTTCTTCAAAGAGCAA
GGACATCGAAGTATTGGCATGGCTCGCAGAGGCGCAGCTGCGGCTGCGCGGCTTCTCTGGATTGCATGAC
GTTTACGTCGCAACCGTGTCGCTTTTAGACAAGCATTTCGACGCTTTGCATTCGATCGGAGATGGTGACG
TCGAGGAACGGTTTGCGCCGTTTGCGGGACTGAACGGCGTCGGCGGCGAAGGAACGCTTATCCAGGCTAT
TCGTTTGACATCGTTGATCCCCGGCGGAAAGTTCGCGCAGTTTTCGCTTTGGGATTTCCAGCTTTCGCAG
CGGCCGAACGAAACCGAACGACGCAAGGAATTGCAGCAGGCGGCAGCGGAAGCCGGTGTCGCTCAGATGT
CAGCCTATCTCGACGTGCTGACCGGATGCATCGCCGCTTTCGATCGCATGGTCGAAATACTTGACGAACA
CTGCGGCGACCAGGCGCCACCGAGTTCGAATACACGCAATGTGTTGCAGGAGGCGGCATCTGCAATCCGG
ATGCTGGCAGGAATCGAAGCGCCGACCGAAGCGCCCTTGGCCGCTCCGCAAGCCCTTGCCTCGCAAGGAT
CCGAGCCACTGCGGGCAGTTGAAACCGACGAGTCCGAAGCCATCGGCCTGCGGCCTGTCAGCGCCGAGAT
GATTCGTTCTCGGGAAGAGGCCTTCGAACTTCTGATCGCCGTTGCGCGCTATTTCCGCCGCACCGAGCCC
CATTCACCGATCTCCATGTCGATCGAAACGCTGGTGCGTCGCGGCCGCATGGATTTTTTTGAGCTTCTTG
CCGAGCTCCTGCCCGAACAGCAGACGCGCAACGCGGTGCTGACGGCAGCCGGCATCCAGCCCGTAGCCGA
CAAGGGAGGCTAA