SecReT6
Protein ID: 116249144
SecReT6 ID147
T6SS typei5
Gene symbol-
Locus tagpRL120480
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]520276..522540 [+]
Productputative fimbrial operon related protein
NoteTssI
UniProt IDQ1M3Y5
KEGG IDrle:pRL120480
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-63, Aligned region: 37..346
Phage_base_V [PF04717], Evalue: 5.10E-19, Aligned region: 385..478
Protein Sequence: 754 a.a.     [Download]
>gi|116249144|ref|YP_764985.1| putative fimbrial operon related protein [Rhizobium leguminosarum bv. viciae 3841]
MDDLQSLAADFIQANRILKIVSPLGEDQLLPERVTIEEGISSLFEIRLSARAKKPSVKPEELIGRLMDVS
VEVQQGDDGGGVRRPFNGLVTELNEGPPITRGLRSYSMVLRPQMWLLSRRSDCRIWMDKTAVDIVETLFS
EHGIPAPDTSGVITPPPPQHYSVQWNETDLAYLTRRFEEDGLFYWFSHEDGKHKLHVADGARSWLGPSPS
AQGEGRVRLAQGSSDRNHINEWSRRYSYVPGQRAGADWNFETPRMVPGTMTPSLVQMPEATKRELYEYPA
RISSVTEAERAEKLRMQASEADHDRVFGASTSRILEAGRRFTPYEVAHPDHVYEEHVVVKAVHTVVDRSY
ETNSNEPEYTNTFEAVPSRVAMTPHRETKRPRIEGTQVAIVAGPSGEEIHPDQYGRIKLWFPWDRKAKKD
GSDTCWVRVSQVWGGGTWGAQVIPRIGMEVMVAFVDGDPDRPLVTGVVPNPSNAVPYDLPANKTRMVMRS
NTHKGTGFNEMTFEDESGQENMFFHAQKDQTTRVLNDRTKRIDRHEVSAIGANRTVEVGGNQKHEVGGSM
NTVVGGTGPMAMALMGAVSGLSGHTAGLLAQAGQIAGGGGPGLAAFAGTLASSALGFLGAGGLGSREGVV
SGPSPRADAGTALAGSGTGVGDAASGLFPLPGIMNTIVGSFKSDTIGIARAEQIGVSKVTNVGQTSLESV
GKFKKIAVGEEFVIECGDSKFIMKANGEVIILGKTFNFVATEHFQMRGKPIDLN
 
Nucleotide Sequence: 2265 bp     [Download]
>gi|116248676|ref|NC_008378.1|:520276-522540 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGGACGATTTGCAATCCCTCGCCGCGGATTTCATCCAGGCGAACCGTATTCTGAAGATCGTCTCGCCGC
TCGGCGAAGACCAGCTTCTGCCGGAGCGGGTGACGATCGAGGAAGGTATTTCCTCGCTCTTTGAAATCAG
GCTTTCGGCCCGCGCCAAGAAGCCGTCCGTCAAGCCGGAGGAACTGATCGGCCGGCTGATGGATGTCTCC
GTCGAGGTGCAGCAGGGTGACGATGGCGGCGGCGTGCGCCGGCCGTTCAACGGCCTGGTGACCGAACTCA
ACGAGGGGCCGCCCATCACCCGCGGCCTCAGATCCTATTCCATGGTGCTGCGGCCGCAAATGTGGCTCCT
TTCGCGCCGTTCCGACTGCCGCATCTGGATGGATAAGACCGCGGTCGATATCGTCGAGACGCTGTTTTCC
GAGCACGGCATCCCGGCGCCGGATACCTCAGGCGTGATCACACCACCGCCGCCGCAGCATTATTCGGTGC
AGTGGAACGAAACGGACCTAGCCTATCTCACCCGCCGTTTCGAGGAAGACGGCCTGTTCTATTGGTTCTC
CCATGAGGACGGCAAACACAAGCTGCATGTGGCCGATGGTGCAAGATCCTGGCTCGGTCCGTCGCCCTCG
GCGCAGGGTGAGGGGCGGGTTCGCCTCGCGCAAGGCTCCTCGGATCGCAACCATATCAACGAGTGGAGCC
GGCGCTATTCCTATGTGCCGGGCCAGCGGGCAGGCGCCGACTGGAATTTCGAAACGCCGCGCATGGTGCC
GGGCACCATGACCCCGTCGCTGGTGCAGATGCCGGAAGCGACCAAGCGCGAGCTTTACGAATATCCGGCG
CGCATTTCTTCCGTGACCGAGGCGGAGCGGGCGGAAAAACTCAGGATGCAGGCCTCCGAAGCAGATCACG
ACCGGGTCTTCGGCGCCTCCACATCCCGCATTCTGGAGGCGGGGCGCCGCTTCACCCCCTATGAAGTCGC
CCATCCCGACCACGTCTATGAGGAACATGTGGTGGTCAAGGCGGTGCATACCGTCGTCGACCGTTCCTAC
GAGACGAACAGCAACGAGCCGGAATACACGAACACATTCGAGGCGGTGCCGTCGCGGGTGGCGATGACGC
CGCATCGCGAGACGAAACGGCCGCGGATCGAGGGCACCCAGGTGGCGATCGTCGCCGGCCCTTCCGGCGA
GGAAATCCATCCCGACCAGTACGGTCGCATCAAGCTGTGGTTCCCTTGGGATCGCAAGGCCAAGAAGGAC
GGTTCCGACACCTGCTGGGTGCGCGTCAGCCAGGTCTGGGGAGGCGGGACCTGGGGCGCCCAGGTCATCC
CGCGCATCGGCATGGAGGTGATGGTCGCCTTCGTCGACGGCGATCCCGACCGGCCGCTGGTGACGGGCGT
GGTGCCCAATCCCAGCAATGCAGTTCCTTACGACCTGCCGGCCAACAAGACGCGTATGGTCATGCGCTCG
AACACGCATAAGGGCACTGGCTTCAACGAGATGACGTTCGAAGACGAGTCTGGCCAGGAAAACATGTTCT
TCCATGCGCAGAAGGACCAGACGACGCGCGTACTGAATGACCGCACCAAGCGCATCGATCGCCACGAAGT
TTCGGCGATCGGCGCCAACCGAACGGTCGAAGTCGGCGGCAACCAGAAACACGAAGTCGGCGGTTCGATG
AACACCGTCGTCGGCGGCACGGGGCCGATGGCAATGGCGCTTATGGGGGCTGTCAGCGGTCTTTCCGGAC
ATACGGCCGGGCTGCTGGCGCAGGCTGGGCAAATTGCAGGCGGCGGTGGGCCGGGGCTTGCCGCCTTTGC
CGGCACGCTTGCGTCGTCGGCGCTTGGTTTCCTAGGCGCCGGTGGTCTTGGCAGCCGTGAAGGGGTCGTC
TCGGGGCCAAGCCCGCGCGCCGATGCCGGTACGGCACTTGCCGGTTCAGGGACCGGTGTGGGCGATGCCG
CCTCCGGCCTGTTTCCGCTGCCCGGCATCATGAACACCATCGTCGGCTCGTTCAAATCCGACACGATCGG
CATCGCCCGCGCCGAGCAGATCGGCGTCAGCAAGGTGACCAATGTCGGCCAGACATCGCTGGAGAGCGTC
GGAAAATTCAAGAAGATCGCCGTCGGCGAGGAATTCGTCATCGAATGCGGCGATTCCAAATTCATCATGA
AGGCGAATGGCGAAGTGATCATCCTCGGCAAGACGTTCAACTTCGTCGCCACCGAACACTTCCAGATGCG
CGGCAAGCCGATTGATCTGAACTGA