SecReT6
Protein ID: 117617832
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1841
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2007876..2010518 [+]
ProductClpA/ClpB family protein
NoteTssH
UniProt IDA0KJC4
KEGG IDaha:AHA_1841
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.40E-38, Aligned region: 222..321
AAA_2 [PF07724], Evalue: 3.40E-38, Aligned region: 617..778
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 222..321
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 554..578
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 623..741
AAA_5 [PF07728], Evalue: 3.40E-14, Aligned region: 222..247
AAA_5 [PF07728], Evalue: 3.40E-14, Aligned region: 622..740
ClpB_D2-small [PF10431], Evalue: 2.10E-13, Aligned region: 784..858
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 199..237
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 593..660
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 688..716
AAA_22 [PF13401], Evalue: 3.10E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 3.10E-07, Aligned region: 440..440
AAA_22 [PF13401], Evalue: 3.10E-07, Aligned region: 621..641
AAA_22 [PF13401], Evalue: 3.10E-07, Aligned region: 684..716
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 278..308
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 616..651
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 415..451
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 483..513
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 623..649
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 829..860
Arch_ATPase [PF01637], Evalue: 6.50E-05, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 6.50E-05, Aligned region: 274..358
Arch_ATPase [PF01637], Evalue: 6.50E-05, Aligned region: 623..658
Arch_ATPase [PF01637], Evalue: 6.50E-05, Aligned region: 693..704
DUF258 [PF03193], Evalue: 7.50E-05, Aligned region: 189..240
DUF258 [PF03193], Evalue: 7.50E-05, Aligned region: 623..640
AAA_10 [PF12846], Evalue: 0.00012, Aligned region: 220..243
AAA_10 [PF12846], Evalue: 0.00012, Aligned region: 284..308
AAA_10 [PF12846], Evalue: 0.00012, Aligned region: 357..458
AAA_10 [PF12846], Evalue: 0.00012, Aligned region: 622..742
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 217..245
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 620..644
AAA_19 [PF13245], Evalue: 0.00075, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00075, Aligned region: 358..399
AAA_19 [PF13245], Evalue: 0.00075, Aligned region: 553..564
AAA_19 [PF13245], Evalue: 0.00075, Aligned region: 614..641
AAA_14 [PF13173], Evalue: 0.00079, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 0.00079, Aligned region: 622..711
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 219..243
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 418..443
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 621..662
IstB_IS21 [PF01695], Evalue: 0.0032, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0032, Aligned region: 622..633
Sigma54_activat [PF00158], Evalue: 0.0033, Aligned region: 221..236
Sigma54_activat [PF00158], Evalue: 0.0033, Aligned region: 622..720
AAA_17 [PF13207], Evalue: 0.0041, Aligned region: 222..293
AAA_17 [PF13207], Evalue: 0.0041, Aligned region: 623..657
AAA_17 [PF13207], Evalue: 0.0041, Aligned region: 800..821
Ras [PF00071], Evalue: 0.0061, Aligned region: 222..235
Ras [PF00071], Evalue: 0.0061, Aligned region: 623..664
Protein Sequence: 880 a.a.     [Download]
>gi|117617832|ref|YP_856375.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MIRIELPVLVERLNPICRHMLEEAAALCVNHQGAEIRIEHLLLKMLETPLSDVRQILKVAEVEVEELKTL
LQPSAADSSYGQGYPSFSPMLVEWLQDSWLLASAELQHAQLRSGVMLLVLLMTPQRYLPGSVTRLLAKVN
RELLRQQFDEWVKESAETQVTNAPGGKTAQTALPADASLLARFTVNVTEQARQGSLDPVLCRDHEIDLMI
DILSRRRKNNPIVVGEAGVGKSALIEGLALRMVAGQVPEKLRGVELMTLDLGAIQAGASVKGEFEKRFKG
VMQEVKDAVQPVILFIDEAHTLIGAGNQAGGLDVSNLIKPALARGELRTIAATTWGEYKKYVEKDAALSR
RFQLVKVGEPDADEATVILRGLRSIYEKAHGVLIDEEALQAAAQLSARYISGRQLPDKAIDVLDTACARV
AINLTTPPRAVSHLQNALRQRELEIRQLERQSLIGLGDNAERLAELQAAQQACREELAEQEARWQQQQGL
VHQIVELRAALLADQQDEMLAREALDLADAPLDPQAAAEQLAILERELAELQQGEVLVSAHVDKTQIAAV
IAEWTGVPLNRISQGELDVVTRLPEYLGELIKGQDVAVAHLHKHLLTARADLRRPGRPLGAFLLVGPSGV
GKTETVLQIAELMFGGRQYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEV
EKAHPDVLNLFYQAFDKGELADGEGRIIDCKNVVFFLTSNLGFQTIVDHAEQPDVLLDALYPELAAFFKP
ALLARMEVIPYLPLGHDTLVQIVGGKLNRLVKLLKERFGAEVVLDDEVAEEILLRANRSENGARMLESVI
DGALLPPVSLQLLQRLSAGEPIKRVHFSVADHQFVAEVGA
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2007876-2010518 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
TTGATTCGTATAGAGCTACCGGTACTGGTGGAAAGACTCAACCCCATCTGCCGTCACATGCTGGAAGAGG
CTGCGGCCCTCTGCGTTAATCACCAGGGAGCCGAGATCCGCATCGAGCATTTGCTCCTGAAGATGCTGGA
GACCCCGCTGAGCGATGTGCGCCAGATCCTGAAGGTGGCCGAGGTGGAGGTGGAAGAGCTCAAGACCCTG
CTGCAACCGTCCGCTGCCGACAGCAGCTATGGCCAGGGTTACCCTTCCTTCTCGCCCATGCTGGTGGAGT
GGCTGCAAGACAGCTGGCTGCTCGCCTCTGCCGAGCTGCAACATGCCCAGCTGCGCAGCGGTGTCATGCT
GCTGGTGCTGCTGATGACCCCCCAGCGCTACCTGCCGGGTTCGGTGACCCGCCTGCTTGCCAAGGTCAAT
CGCGAGCTGCTGCGCCAGCAGTTTGACGAGTGGGTCAAGGAGTCCGCCGAGACGCAAGTGACCAACGCCC
CCGGCGGCAAGACGGCCCAGACCGCCCTGCCAGCCGATGCCAGCCTGCTGGCTCGCTTTACCGTCAACGT
GACCGAGCAGGCCCGCCAGGGCAGCCTGGATCCCGTGCTCTGCCGGGATCACGAAATCGACCTGATGATC
GACATCCTCTCCCGTCGTCGCAAGAACAACCCCATAGTCGTGGGGGAGGCCGGGGTCGGCAAGAGCGCCC
TGATCGAGGGGCTGGCCCTGCGCATGGTGGCGGGTCAGGTGCCCGAGAAGCTGCGCGGGGTCGAGCTGAT
GACCCTGGATCTGGGTGCCATACAGGCCGGCGCCTCGGTCAAGGGGGAGTTCGAGAAGCGCTTCAAGGGG
GTGATGCAGGAGGTCAAGGACGCCGTGCAACCTGTCATCCTGTTCATCGACGAGGCGCACACCCTGATCG
GGGCCGGCAACCAGGCCGGCGGACTGGATGTTTCCAACCTCATCAAGCCGGCGCTGGCCCGGGGCGAGCT
GCGCACCATCGCTGCCACCACCTGGGGCGAGTACAAGAAATACGTGGAGAAAGACGCGGCCTTGTCGCGC
CGCTTCCAGCTGGTGAAAGTGGGTGAGCCCGATGCCGACGAGGCCACGGTGATCCTGCGCGGCCTGCGCA
GCATCTACGAGAAGGCCCACGGGGTGCTGATCGACGAGGAGGCGTTGCAGGCCGCTGCCCAGCTCTCCGC
CCGCTACATCTCCGGCCGTCAGCTGCCGGACAAGGCGATCGACGTGCTCGATACCGCCTGTGCCCGGGTG
GCCATCAACCTCACCACCCCGCCGCGCGCGGTCAGCCACCTGCAAAACGCGCTGCGCCAGCGCGAGCTGG
AGATCCGCCAGCTGGAGCGCCAGAGCCTGATAGGTCTCGGTGACAACGCAGAGCGCCTGGCCGAGTTGCA
GGCGGCCCAGCAGGCTTGCCGTGAAGAACTGGCCGAGCAGGAGGCCCGGTGGCAGCAGCAGCAGGGGCTG
GTACACCAGATTGTCGAGCTGCGCGCAGCCCTGCTGGCCGATCAGCAGGATGAGATGCTGGCCAGAGAGG
CGCTGGATCTGGCCGATGCGCCGCTCGATCCGCAAGCCGCTGCCGAGCAGCTGGCCATCCTCGAGCGCGA
GCTGGCCGAACTGCAGCAAGGAGAAGTGCTGGTCTCCGCCCACGTCGACAAGACCCAGATTGCCGCCGTC
ATCGCCGAGTGGACCGGGGTGCCCCTCAATCGTATCTCGCAAGGGGAGCTCGATGTGGTGACCCGTCTGC
CGGAATACCTCGGCGAGCTCATCAAGGGGCAGGATGTGGCGGTGGCTCACCTGCACAAGCACTTGTTGAC
CGCCCGCGCGGACCTGCGTCGTCCCGGCCGGCCGCTCGGCGCCTTCCTGCTGGTGGGACCGAGCGGGGTC
GGCAAGACCGAAACCGTGCTGCAGATCGCCGAGCTGATGTTCGGTGGCCGCCAGTATCTGACCACCATCA
ACATGTCCGAGTATCAGGAGAAGCACACCGTCTCGCGCCTGATCGGCTCGCCGCCCGGCTACGTCGGTTT
TGGCGAGGGGGGCGTGCTGACCGAGGCCATTCGGCAGAAACCTTACTCCGTGGTGCTGCTGGATGAGGTG
GAGAAGGCCCACCCGGACGTGCTCAACCTCTTCTATCAGGCGTTTGACAAGGGCGAGCTGGCGGACGGGG
AAGGGCGTATCATCGACTGCAAGAACGTGGTCTTCTTCCTCACCTCCAACCTCGGTTTCCAGACCATCGT
GGATCACGCCGAGCAGCCCGACGTGCTGCTGGACGCCCTCTATCCGGAGCTCGCCGCCTTCTTCAAGCCG
GCGCTGCTGGCGCGCATGGAGGTGATCCCCTATCTGCCGCTCGGTCACGATACCCTGGTACAGATCGTGG
GCGGCAAGCTCAACCGGCTGGTCAAGCTGCTCAAGGAGCGCTTTGGCGCCGAGGTGGTGCTGGACGACGA
GGTGGCCGAGGAGATCCTGCTGCGGGCCAATCGCAGCGAGAACGGTGCCCGCATGCTCGAATCCGTCATC
GACGGTGCCCTGCTGCCGCCTGTTTCCCTGCAACTGCTGCAGCGCCTCTCGGCCGGTGAACCCATCAAGC
GCGTCCACTTTTCCGTGGCCGATCACCAGTTTGTGGCCGAGGTGGGGGCTTGA