SecReT6
Protein ID: 117617929
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1834
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2000731..2001162 [+]
Producthypothetical protein
NoteTssE
UniProt IDA0KJB7
KEGG IDaha:AHA_1834
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-21, Aligned region: 32..123
Protein Sequence: 143 a.a.     [Download]
>gi|117617929|ref|YP_856368.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MPHLSSWDRGNAASLFDRIRGEGLGSSPRSESEELIASVKRQLEQVLNTRPGNCRSAPDLGVIDLNDATQ
GSADIKGRIREAIRQCIRRYEPRIVHVDVRSPDYQASPLEMSFQVTAHVRLEHIEQVTSFNVHMDSHRHY
RMV
 
Nucleotide Sequence: 432 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2000731-2001162 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGCCGCATCTCTCTTCCTGGGATAGAGGAAATGCGGCCAGCCTGTTTGATCGTATCCGGGGGGAGGGGC
TTGGCTCCTCTCCCCGCTCGGAGTCTGAAGAACTGATCGCATCTGTCAAACGGCAGCTCGAGCAGGTTCT
CAACACCCGCCCCGGCAATTGCCGCAGTGCACCCGATCTGGGGGTCATTGATCTCAATGACGCCACTCAG
GGCAGTGCGGATATCAAGGGGCGGATCCGGGAGGCGATCCGGCAATGCATCCGTCGTTATGAACCACGGA
TCGTGCATGTGGATGTTCGTTCACCCGACTATCAGGCGAGCCCGCTTGAGATGTCGTTTCAGGTGACGGC
CCACGTGCGGCTGGAGCATATCGAGCAAGTTACCTCGTTCAACGTCCATATGGACAGTCACCGTCACTAC
CGCATGGTCTGA