SecReT6
Protein ID: 117618870
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1839
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2005719..2007053 [+]
Producthypothetical protein
NoteTssK
UniProt IDA0KJC2
KEGG IDaha:AHA_1839
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-159, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|117618870|ref|YP_856373.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MSSRNRVIWREGLFIKPQHFQQQQRHSDYALHARLSALSDYFYGLQSLAINEDYLGFGRIALVGATGILP
DGTVFNIPNDDVLPTPLEVTDASVANQKVYLALPLSVSGVNEVGQGGQVATRLQAHRHDVRDLHSEGGDV
VSLEVGRVSLRLMLEREDRSAYASLAIARILDKRPDGGLVLDPNFMPCSISVSAIPTLKRFLGESAGLVA
ERARSLSQRIAAPGQQGVADVAEFMMLQLLNRAQPQLSHLARLGTLHPERLHEALVQLCGELMTFTDESR
LPPEFSAYRHDDQQVSFEPVMLALRQALSTVLSPRAVSIQLRKHQYGIMVAMVNESELMQSADFVLAVRA
RMPQEQLRKQLLQQTKVASSDKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQMLAVG
NTLAFHIAGDFPELDMQLWAIRSQ
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2005719-2007053 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGTCGAGTCGAAATCGGGTTATCTGGCGTGAGGGGCTCTTCATCAAGCCCCAGCACTTCCAGCAACAAC
AAAGACATTCGGATTACGCGCTGCACGCTCGCCTGAGCGCGCTGTCCGATTATTTCTATGGCTTGCAGTC
GCTCGCCATCAACGAGGATTACCTGGGTTTTGGTCGCATCGCCCTGGTGGGGGCCACCGGCATCCTGCCG
GACGGTACCGTGTTCAACATCCCCAATGACGACGTGCTGCCGACCCCGCTGGAGGTCACCGACGCCTCGG
TGGCCAACCAGAAGGTCTATCTGGCCCTGCCGCTCTCGGTGAGCGGCGTCAATGAGGTGGGGCAGGGCGG
TCAGGTGGCTACCCGGTTGCAGGCCCATCGCCACGACGTGCGCGATCTGCACAGCGAAGGGGGGGACGTG
GTTTCCCTCGAAGTGGGGCGGGTCAGCCTGCGGCTGATGCTGGAGCGCGAGGATCGCAGCGCCTATGCGT
CGCTCGCCATCGCCCGCATTCTGGACAAGCGTCCGGACGGCGGCCTGGTGCTGGATCCCAACTTCATGCC
CTGCAGCATCAGCGTCTCCGCCATCCCGACCCTCAAGCGCTTCCTCGGTGAGTCGGCCGGGTTGGTCGCC
GAGCGGGCTCGTAGCCTCTCCCAGCGCATCGCCGCGCCGGGTCAGCAGGGGGTGGCCGATGTGGCCGAGT
TCATGATGCTGCAGCTGCTCAACCGGGCCCAGCCCCAGCTTTCCCATCTGGCGCGCCTTGGCACCCTGCA
CCCCGAGCGGCTGCACGAGGCGCTGGTGCAGCTCTGCGGCGAGCTGATGACCTTTACCGACGAGTCCCGC
CTGCCGCCCGAGTTCTCTGCTTACCGTCACGACGATCAGCAGGTGAGCTTCGAGCCGGTGATGCTGGCCC
TGCGCCAGGCGCTCAGCACCGTGCTGTCGCCGCGCGCCGTCTCCATCCAGCTGCGCAAGCACCAGTACGG
CATTATGGTGGCCATGGTCAACGAGAGCGAGCTGATGCAGAGCGCCGACTTCGTATTGGCGGTGCGTGCC
CGCATGCCGCAGGAGCAGCTGCGCAAGCAGTTGCTGCAGCAGACCAAGGTGGCCTCCAGCGACAAGATCC
GCGAGCTCATCAGCCTGCAGCTGCCCGGCATTCCGCTGCTGCCGCTGCCGGTGGCGCCGCGGCAGCTGCC
CTATCACGCCGGTTACAGCTACTTCCAGCTCGACCGGCAGAGCCCGGCCTGGCAGATGCTGGCGGTGGGC
AACACCCTTGCCTTCCACATCGCCGGCGACTTCCCCGAGCTCGACATGCAGCTCTGGGCCATTCGCAGCC
AGTGA