SecReT6
Protein ID: 117618948
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1832
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]1998704..1999207 [+]
Producthypothetical protein
NoteTssB
UniProt IDA0KJB5
KEGG IDaha:AHA_1832
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-57, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|117618948|ref|YP_856366.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MGKNIDGATVAPKERINIKYVPATGGQQGEVELPLTMMVVGNMKGRTEDTPIEERQTVSIDKNNFSSVMK
ESALELKFSVPNRLEENSQDALPVSINIQSLEDFTPDRVAQQIPELRKLLELREALVALKGPLGNIPAFR
NRLQDLLSSDEAREQLLKELDLIKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|117617447|ref|NC_008570.1|:1998704-1999207 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGGGAAAAAATATCGATGGCGCTACCGTTGCGCCCAAAGAACGTATCAATATCAAATATGTACCGGCGA
CCGGTGGACAGCAGGGAGAAGTTGAACTTCCGTTGACCATGATGGTAGTCGGCAATATGAAGGGCCGTAC
CGAAGACACCCCGATCGAGGAGCGTCAGACCGTCTCCATCGACAAGAATAATTTTTCGTCCGTCATGAAA
GAATCCGCACTGGAACTGAAGTTTTCCGTTCCCAATCGTCTGGAAGAGAACAGCCAGGATGCATTGCCGG
TTTCGATCAATATCCAGTCTCTGGAAGACTTCACTCCTGACCGCGTGGCCCAGCAAATACCTGAGCTGCG
CAAGCTGCTGGAGCTGCGCGAAGCGCTGGTTGCCCTGAAGGGGCCACTGGGAAATATCCCTGCCTTCCGC
AATCGTTTGCAGGATCTGCTGTCCAGTGATGAAGCTCGTGAGCAACTGCTCAAGGAGCTGGATTTGATTA
AGCCTGCCGAGTGA