SecReT6
Protein ID: 117619347
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1840
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2007145..2007855 [+]
Producthypothetical protein
NoteTssL
UniProt IDA0KJC3
KEGG IDaha:AHA_1840
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-68, Aligned region: 15..220
Protein Sequence: 236 a.a.     [Download]
>gi|117619347|ref|YP_856374.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MDSDYWFRLRGQSINPMIDAVTPLLGLVQRVRLLSRYDRVPELYQRVVTEIQAIEQELMAQGYENGVVLS
FRYILCTFIDEAVMGRDWGSQSEWSEHSLLTRFHNETWGGEKVFVLLARLQEDPVRYRDILEFIYLCLCL
GFEGRYKVMSKGQGEFERIVRQLHKQLAPEAGGEAPSVFHLDLGQQASRYQLRKQVSLRSLFMGGALILA
LIFGLYHHQLNNQTQDVLRQLGELLK
 
Nucleotide Sequence: 711 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2007145-2007855 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGGATTCGGATTACTGGTTCCGCCTGCGCGGCCAGAGCATCAACCCGATGATCGATGCGGTGACCCCCT
TGCTGGGGCTGGTGCAGCGGGTGCGCCTGCTGTCGCGCTACGACCGGGTGCCCGAGCTTTATCAGCGGGT
GGTGACCGAGATCCAGGCCATCGAACAGGAGCTGATGGCCCAGGGCTACGAGAACGGGGTGGTGCTGTCG
TTTCGCTACATCCTCTGCACCTTCATCGACGAGGCCGTGATGGGCCGCGACTGGGGCAGTCAAAGCGAAT
GGTCCGAGCACTCCCTGCTGACCCGCTTTCACAACGAGACCTGGGGCGGCGAGAAGGTGTTCGTGCTGCT
GGCCCGCCTGCAGGAAGACCCGGTGCGTTATCGCGACATTCTGGAGTTCATCTACCTCTGTCTGTGCCTC
GGTTTCGAGGGGCGTTACAAGGTGATGAGCAAGGGACAAGGGGAGTTCGAGCGCATCGTGCGCCAGCTGC
ACAAGCAGTTGGCCCCCGAGGCCGGCGGCGAGGCGCCCAGCGTGTTTCACCTCGATCTGGGTCAGCAGGC
CTCCCGCTATCAGCTGCGCAAGCAGGTATCCCTGCGCAGCCTGTTCATGGGCGGCGCGCTGATCCTGGCG
CTGATCTTTGGCCTCTATCACCACCAACTCAATAACCAGACCCAGGACGTGCTGCGTCAACTGGGCGAAT
TATTAAAATAA