SecReT6
Protein ID: 117619565
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1835
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2001166..2002932 [+]
Producthypothetical protein
NoteTssF
UniProt IDA0KJB8
KEGG IDaha:AHA_1835
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.50E-201, Aligned region: 3..588
Protein Sequence: 588 a.a.     [Download]
>gi|117619565|ref|YP_856369.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MSLEHYFRDELAFLRLQGREFADAYPELTRFLSEQNTDPDVERLLEGFAFLTGNLRAKIEDEFPELTHGL
LNMLWPNYLRPVPSMTIMQFSVIPGAIAQPALVRQGCQLDSLPLDEVTCHFQTCHDTWVYPADIRHIAAQ
SGNDLSTISLDIALHAPLPLSELQLDKLRFFLGGDSYTAYELYFWLSNQLSHIELEIDGKRFRQEAKALK
SVGFERDDALLPYPNNVYSGYRILQEYFCFPESFLFFELSGGEWPKQPLPVSEFKVHFCFDRPLPAELKI
RPDSFMLNCVPAINLFQHDSEPVNLNGRQAEYPLKASYRHADSFEIFSVDQVEGWVEGNLGRSRGTPRIY
QPFESFQHQIERAKQRLALYYRVRVKEAVSGDGFEHSLSFVRGDETTTVELDESISVTLTCTNRSRAARL
KVGSVCVPTGSSPSFATFRNLIRPTRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQVLRTYDFPALH
DKQAEQASRKRLAGIEEIETKPVDRLVRGMPVRGLKSVLSIRQSAFGSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNLDNKERYQWPVQIGQHSLM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2001166-2002932 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGTCGCTGGAACATTACTTCAGGGATGAACTGGCTTTTTTGCGCCTGCAAGGGCGCGAATTTGCCGACG
CCTATCCCGAGCTCACCCGCTTTCTGTCGGAGCAGAATACCGATCCGGACGTGGAGCGCCTGCTGGAGGG
GTTCGCCTTTCTCACGGGCAACCTGCGCGCCAAGATTGAGGATGAGTTTCCCGAGCTGACCCACGGTCTG
CTCAACATGCTCTGGCCCAACTACCTGCGTCCCGTGCCCAGCATGACCATCATGCAGTTTTCGGTCATTC
CGGGCGCCATTGCCCAGCCGGCGTTGGTCAGGCAAGGCTGCCAGCTCGACAGTCTGCCCCTGGACGAGGT
GACCTGTCATTTCCAGACTTGTCACGATACCTGGGTCTATCCGGCCGATATCCGTCATATCGCTGCCCAG
AGCGGCAACGATCTCTCCACCATCTCGCTGGATATCGCCCTGCATGCCCCTCTGCCGCTGAGCGAACTGC
AGCTGGACAAGCTGCGCTTCTTCCTCGGTGGCGACAGCTACACCGCCTATGAGCTCTACTTCTGGCTCTC
CAACCAGCTCTCCCATATCGAGCTGGAGATCGACGGCAAGCGCTTTCGCCAGGAGGCCAAGGCCCTCAAG
TCGGTCGGCTTCGAGCGCGATGACGCGCTCTTGCCCTATCCGAACAACGTCTATTCTGGCTACCGGATCC
TGCAGGAGTACTTCTGCTTCCCGGAAAGCTTCCTCTTCTTCGAACTCTCTGGTGGCGAGTGGCCCAAACA
GCCGTTGCCGGTGAGCGAATTCAAGGTGCACTTCTGCTTCGACCGACCGCTGCCGGCGGAGCTCAAGATC
CGTCCCGACTCCTTCATGCTCAACTGCGTGCCGGCCATCAACCTGTTCCAGCACGACAGCGAGCCGGTCA
ACCTCAATGGCCGTCAGGCGGAGTATCCCCTCAAGGCAAGTTATCGCCACGCCGACAGCTTCGAGATCTT
CTCGGTGGATCAGGTGGAGGGCTGGGTCGAGGGGAACCTCGGCCGCTCCCGCGGCACGCCGCGCATCTAT
CAGCCATTCGAGAGCTTTCAGCACCAGATCGAGCGGGCCAAGCAGCGGCTGGCGCTCTACTACCGGGTGC
GGGTCAAGGAGGCGGTGAGCGGGGATGGTTTCGAACACAGCCTCTCGTTCGTGCGTGGGGATGAAACCAC
CACGGTCGAACTGGATGAATCCATCTCGGTGACGCTCACCTGCACCAACCGCTCCCGCGCCGCCCGCCTC
AAGGTGGGCAGCGTCTGCGTGCCGACCGGCAGCTCGCCCTCGTTTGCCACCTTCCGCAACCTGATCCGGC
CGACCCGGCCGCTGCGCCCGGCGCTGGACGGCAGTCTGCACTGGACGCTGATATCCAACCTGTCGCTCAA
CTATGTCTCCCTGCTGCGCCGCGATGCCCTGGTGCAGGTGCTGCGCACCTACGATTTTCCGGCGCTGCAC
GACAAGCAGGCCGAGCAGGCCTCGCGCAAGCGGCTGGCGGGGATCGAGGAGATCGAGACCAAGCCGGTGG
ACCGGCTGGTGCGCGGCATGCCGGTGCGGGGGCTCAAGTCGGTGCTCTCCATCCGCCAGTCCGCCTTCGG
CAGTGAAGGGGAGCTCTATCTGTTCAGTACCGTGCTGGCCCACTTCTTCTCGCTCTATGCCAGCGTCAAC
GCCTTCCACCTGCTTGAGGTGGTCAATCTCGACAACAAGGAGCGCTACCAATGGCCAGTCCAGATCGGTC
AGCACTCCCTGATGTGA