SecReT6
Protein ID: 117619691
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1837
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2003951..2005201 [+]
Producthypothetical protein
NoteFha
UniProt IDA0KJC0
KEGG IDaha:AHA_1837
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.60E-06, Aligned region: 34..101
Protein Sequence: 416 a.a.     [Download]
>gi|117619691|ref|YP_856371.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MDDFNQQLSLVVLNSEQLDGSQQVQYRFDEMGGTLGASEQDDWQLRDRLGAVMPAHARIELNDGRFCLCD
LSGQTYINGATSPIGRARKVHLEQGDELVVGPFRLRAYLGAITPEQSLQQVLGNRPTEQLDEWLTSDEPV
VPADDPRTLAADPLLALQQERRAPNPLMDGPLADGRLQASLRSQPDVDVPPLAPFSAVENTMNQEFLDMP
AIENHPDYQLSLDGVDHVALTPLMRGLGQPLQLQDTQQAHDMLEEMGKTVRAMVEGLLQLQNEQAALADK
HLRPIEDNPLRLGLDYDETLAVLFAEQKSPVHLSAPAAVAESLHNVRIHHVANQQAIGAALDSILQAFSP
QALLGRFEQYRRSGAPGTADEGWAWDMYQHYYRELTSARQQGFDKLFHQVYAQAYDQAVRQQQGLI
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2003951-2005201 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
GTGGACGATTTTAACCAGCAACTTTCCCTGGTGGTGCTCAACAGCGAACAGCTCGACGGCAGCCAGCAGG
TGCAGTACCGCTTCGATGAGATGGGGGGGACCCTGGGGGCCTCCGAACAGGATGACTGGCAACTGCGCGA
CAGGCTGGGGGCCGTCATGCCCGCCCACGCCCGCATCGAGCTCAACGACGGTCGCTTCTGCCTGTGCGAT
CTGAGCGGCCAGACCTATATCAACGGTGCCACCTCGCCCATCGGACGGGCTCGCAAGGTGCATCTGGAGC
AGGGGGACGAGCTCGTGGTCGGCCCGTTCCGGCTGCGCGCCTATCTGGGGGCCATCACCCCCGAGCAGAG
CCTGCAACAGGTGCTGGGCAATCGCCCCACCGAGCAGCTCGACGAGTGGCTGACCAGCGATGAGCCCGTC
GTGCCGGCTGACGATCCGCGCACCCTGGCGGCCGATCCCTTGCTGGCATTGCAGCAGGAGCGCAGAGCGC
CCAATCCGTTGATGGATGGTCCGCTGGCGGACGGTCGCCTGCAGGCTTCACTGCGTTCACAACCGGATGT
GGACGTTCCCCCTCTTGCCCCTTTTTCTGCTGTCGAGAACACCATGAACCAAGAATTTCTGGATATGCCC
GCCATCGAGAACCATCCCGATTATCAGCTGTCGCTGGACGGCGTCGATCACGTGGCCCTGACCCCGCTGA
TGCGCGGCTTGGGTCAACCCTTGCAACTGCAGGACACCCAGCAGGCCCACGACATGCTCGAAGAGATGGG
CAAGACGGTGCGGGCCATGGTGGAGGGGTTGCTGCAACTGCAAAACGAGCAGGCTGCGCTGGCGGACAAG
CACCTGCGCCCCATCGAGGACAACCCGCTGCGTCTGGGCCTTGATTATGACGAGACCCTGGCGGTGCTGT
TTGCCGAGCAGAAGAGCCCGGTCCACCTGAGCGCACCGGCGGCGGTGGCCGAGAGCCTGCACAACGTGCG
CATCCACCACGTGGCGAACCAGCAGGCCATCGGTGCGGCGCTCGACAGCATCCTGCAGGCGTTTTCGCCG
CAGGCCCTGCTGGGGCGCTTCGAGCAATACCGCCGCAGCGGTGCACCGGGCACGGCCGATGAAGGATGGG
CCTGGGACATGTACCAGCATTACTACCGCGAGCTCACCTCTGCCCGCCAGCAGGGGTTCGACAAGCTGTT
CCACCAGGTGTATGCCCAGGCCTATGACCAGGCCGTGCGTCAGCAACAGGGACTGATTTGA