SecReT6
Protein ID: 117620092
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1848
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2019669..2021714 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDA0KJD1
KEGG IDaha:AHA_1848
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 29..325
Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 551..585
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 372..465
DUF2345 [PF10106], Evalue: 0.0011, Aligned region: 570..620
Protein Sequence: 681 a.a.     [Download]
>gi|117620092|ref|YP_856382.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MADSTGLQFTVKVGALPESTFVVAEFALEEGLNRPFNLRLELASAQPDIDFGAVLDQPCELLVWYNGELQ
RRVCGVVSDFAQGDSGFRRTRYQLMVQPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNE
HVKREYCVQYRESDLDFVNRLAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYV
RQFHYREAVRPSDVELKDYSFKTPAYGLSHKKVGTELEHQRDTYQHFDFPGRYKQDPSGKAFAQHRLDAL
RNDAVAGQAKSNCAALLPGQTFSLTEHPNDSLNTDWQIVRIQHTGLQPQALEEEGGSGPTVYHNEFGVVK
ASTTWRARIGSPEAPHKPMVDGPQIAMVVGPEGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGW
AGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTKTVLRTETHQGEGFNELRF
EDQAGQEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVD
ASLHQKLGQSLLVEAGQEVHIKVGDKLVLEAGSEITLKGGGSFVKVDPSGIKLVGPAIKLNAGGSAGSGS
GWAGQPPIIPKGVEVVKAPELVELVKAIATEKAMEALLKALEPDSDYQPSA
 
Nucleotide Sequence: 2046 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2019669-2021714 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCCCTGCCCGAGAGCACTTTCGTGGTGG
CCGAGTTTGCGCTGGAGGAAGGACTCAACCGGCCGTTCAACCTGCGCCTGGAGCTGGCGAGTGCCCAGCC
CGACATCGACTTTGGCGCCGTGCTGGACCAGCCGTGCGAACTGCTGGTGTGGTACAACGGCGAGCTGCAG
CGCCGGGTGTGCGGAGTGGTCAGTGACTTCGCGCAAGGGGACAGCGGTTTTCGCCGCACCCGCTATCAGC
TCATGGTGCAGCCGGCGCTGTGGCGGCTCTCTTTGCGCCAGAACTCCCGCATCTTCCAGGCGCAGAAGCC
CGACGAAATCCTCTCAATCTTGTTGCAAGAGCACGGCATCACCGATTACGCCTTTGCGCTCAAGAACGAG
CATGTCAAGCGGGAATACTGTGTTCAGTATCGCGAGTCCGACCTCGATTTCGTGAACCGGCTCGCCGCCG
AAGAGGGGATGTTCTACTTCCACGAGTTTGAAGCGGGCAAGCACCGCATTGTGTTTGCCGATGACGCTGC
CGCCCTGACTGCCGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGTTCCCTCGAGCAAGGCCCCTATGTC
CGGCAGTTCCACTATCGGGAGGCGGTACGCCCGTCGGATGTGGAGCTCAAAGACTACAGCTTCAAGACGC
CGGCTTACGGCCTCTCCCACAAGAAGGTGGGGACGGAGCTCGAGCATCAGCGGGATACCTACCAGCACTT
CGATTTTCCGGGCCGCTACAAGCAGGACCCGAGCGGCAAGGCATTTGCCCAACATCGGCTGGATGCGCTG
CGCAATGACGCGGTGGCGGGCCAGGCTAAGTCCAACTGCGCCGCCTTGCTGCCGGGCCAGACGTTTTCAC
TCACTGAACACCCCAACGACAGCCTCAACACCGACTGGCAAATCGTGCGCATCCAGCACACCGGCTTGCA
GCCGCAGGCGCTGGAAGAGGAGGGGGGCAGCGGCCCCACCGTCTACCACAACGAATTTGGCGTGGTGAAG
GCGAGCACCACCTGGCGGGCGCGTATCGGCAGCCCGGAAGCCCCTCACAAGCCGATGGTGGACGGCCCGC
AAATCGCCATGGTGGTGGGCCCCGAAGGGGAAGAGATTTACTGCGACGAACACGGCCGGGTGAAGCTGCA
ATTCCCGTGGGACCGCTACGGCAGCTCCAACGACCAAAGCTCCTGCTGGGTGCGAGTCTCGCAAGGCTGG
GCGGGCGGTCAGTACGGCATGATGGCCATCCCGCGCATCGGCCACGAGGTCATTGTGTCATTCCTGGAGG
GGGACCCCGACCAGCCCATCGTGACTGGGCGCACCTATCACGCCACCAACCGGCCTCCTTATGAGCTACC
TGCCAACAAGACCAAGACCGTGCTGCGCACCGAAACCCATCAGGGGGAAGGTTTTAACGAGCTGCGCTTT
GAAGACCAGGCGGGGCAGGAAGAGATCTACATCCACGGTCAGAAAGACCTGAACGTGCTTATCGAAAATG
ATGCGGCGTGGCATATCAAGCACGACCAGCACACCGATATCGACAACGAGCGGGTGACCCGCATCAAGGC
CAACGACCACCTGACGGTGGAGGGCGAGAAGCGCGACCAGATAAAAGCCGACTACTCACTGACGGTGGAT
GCCAGCCTGCATCAGAAGCTGGGGCAGTCCCTGCTGGTGGAAGCCGGGCAGGAAGTGCATATCAAGGTGG
GCGACAAGCTGGTGCTGGAGGCGGGTTCTGAAATAACCCTCAAGGGAGGCGGCAGCTTTGTGAAAGTGGA
TCCTAGCGGCATCAAGCTGGTGGGCCCCGCCATCAAACTCAATGCTGGCGGCAGCGCAGGTTCAGGCTCT
GGCTGGGCAGGTCAGCCTCCCATCATCCCCAAAGGCGTGGAAGTGGTGAAAGCCCCTGAACTGGTTGAAC
TGGTCAAGGCTATTGCCACCGAGAAGGCGATGGAAGCGTTGCTCAAGGCGCTGGAGCCCGATAGCGATTA
TCAGCCCTCCGCTTGA