SecReT6
Protein ID: 117620147
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1836
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2002896..2003894 [+]
Producthypothetical protein
NoteTssG
UniProt IDA0KJB9
KEGG IDaha:AHA_1836
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-96, Aligned region: 16..319
Protein Sequence: 332 a.a.     [Download]
>gi|117620147|ref|YP_856370.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MASPDRSALPDVNATREAPRFNFFQLVELLNRLDGADQERGLDYLPGDENIRFKATASLGFPTSDVLQIG
RDGQGRHELEVAFLGLHGSQSPMPGYYLDSLAWEYAQGEQKLGLFLDFFHHRLLTLLHRIWRKYRYHVRF
QDNGEDGFSRLMFALVGLGNEAVCQSLPVNRAKMLSYAGMLASPSRSPEVVAGLVAHCFDLADVQVSAWQ
WRKVPIHQDQQNRLGGACATLGSDFVIGDKVNDCAGKFLLKINNLSFGQFLGFLPNGEHFHALVTFVSFI
LRDQLAWDLRLGFGQEQARGLRLGEEQSARLGWSTFLGQPPSDPFVTICVQE
 
Nucleotide Sequence: 999 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2002896-2003894 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGGCCAGTCCAGATCGGTCAGCACTCCCTGATGTGAACGCCACCCGGGAGGCGCCCCGCTTCAACTTCT
TCCAGCTGGTTGAGCTGCTCAACCGGCTCGATGGCGCCGATCAGGAGCGAGGGCTCGACTACCTGCCGGG
TGACGAGAACATCCGCTTCAAGGCGACCGCCTCTCTGGGATTTCCCACCAGCGACGTGCTGCAGATTGGC
CGGGACGGGCAGGGCCGCCACGAGCTGGAAGTGGCCTTCCTCGGCCTGCACGGCAGTCAGTCGCCGATGC
CCGGCTATTACCTCGATTCGCTGGCGTGGGAGTACGCCCAGGGGGAGCAGAAGCTCGGCCTGTTTCTGGA
CTTCTTCCACCACCGTTTGCTGACGCTGCTGCACCGGATCTGGCGCAAGTATCGCTACCACGTGCGGTTC
CAGGACAACGGCGAGGATGGCTTCTCCCGTCTGATGTTTGCCCTGGTAGGGCTTGGCAACGAAGCGGTAT
GCCAGAGCCTGCCGGTCAACCGGGCCAAGATGCTCTCCTATGCGGGCATGCTGGCCAGCCCCAGCCGCTC
CCCCGAGGTGGTGGCCGGTCTGGTGGCCCACTGCTTCGATCTGGCCGACGTGCAAGTGAGCGCCTGGCAA
TGGCGCAAGGTGCCTATTCATCAGGATCAGCAAAATCGCCTCGGCGGCGCCTGCGCCACCTTGGGGAGCG
ATTTTGTCATCGGTGACAAGGTGAATGACTGTGCCGGCAAGTTCTTGTTGAAGATCAACAACCTGAGCTT
TGGCCAGTTTCTCGGCTTTCTGCCGAACGGGGAGCACTTTCACGCCCTGGTGACCTTCGTCTCCTTCATC
CTGCGTGATCAGCTGGCCTGGGATCTGCGCCTGGGGTTTGGTCAGGAGCAGGCGAGGGGGTTGAGGCTGG
GTGAGGAGCAGAGTGCCCGTCTGGGGTGGAGTACCTTTCTCGGCCAGCCGCCGAGTGATCCGTTCGTGAC
CATCTGCGTGCAGGAATAA