SecReT6
Protein ID: 117620252
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1838
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2005201..2005716 [+]
Productlipoprotein
NoteTssJ
UniProt IDA0KJC1
KEGG IDaha:AHA_1838
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-40, Aligned region: 11..162
Protein Sequence: 171 a.a.     [Download]
>gi|117620252|ref|YP_856372.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MIRALMLGAALLALAGCTTMGKMADVAMNPDIQVGSNDSQPTTLGLSLLAEPDVNPNESGEAAPIEFQVV
LLAEDSKLLATDYDQVTADVEKALGKNYLDHQDYTLLPGQFKYLPPIKLDEKTRYIGVIARYADPDSAEW
RKVIKIKSKGTAYQILVHLRLDEVELQKEEE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2005201-2005716 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGATACGTGCGCTGATGCTGGGCGCCGCGCTGCTGGCCCTGGCAGGTTGTACCACCATGGGCAAGATGG
CCGACGTGGCCATGAACCCGGATATCCAGGTGGGCAGCAATGACAGTCAACCGACGACCCTGGGGCTGAG
CCTGCTGGCGGAGCCTGACGTCAACCCCAATGAGAGCGGGGAGGCGGCGCCCATCGAGTTTCAGGTGGTG
CTGCTGGCCGAAGATTCCAAGCTGCTCGCCACCGACTACGACCAGGTGACCGCGGACGTGGAGAAGGCCC
TTGGCAAGAACTACCTGGACCATCAGGACTACACCCTGCTGCCGGGCCAGTTCAAATACCTGCCCCCCAT
CAAGCTCGACGAGAAGACCCGCTACATCGGGGTGATCGCACGCTACGCCGACCCCGACAGCGCCGAGTGG
CGCAAGGTCATCAAGATCAAGAGCAAGGGAACGGCTTATCAAATCCTGGTGCACCTGCGCCTGGATGAAG
TGGAACTGCAAAAAGAAGAAGAATAA