SecReT6
Protein ID: 117620640
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1826
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]1990515..1991033 [+]
Producthemolysin co-regulated protein
NoteTssD
UniProt IDA0KJA9
KEGG IDaha:AHA_1826
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-34, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|117620640|ref|YP_856360.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIFVQGHEDEMLVQEFQHVVTVPTDPQSGQPAGQRVHRPFKF
TVALNKAVPLMYNSLASGEMLPKVTLKWYRTSVEGKQEHFFSTVLTDATIVDIDCQMPHCQDPAKSDFTQ
LIQVSMAYRKIDWEHTVAGTSGADDWRAPIEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|117617447|ref|NC_008570.1|:1990515-1991033 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGCCAACTCCATGTTATATCAGCATCGAAGGTAAAACCCAGGGCAATATCACCGCTGGTGCCTTCACTT
CCGATTCCGTCGGCAACATCTTCGTGCAGGGTCACGAAGACGAGATGCTGGTGCAAGAGTTTCAACACGT
CGTGACCGTCCCGACTGATCCGCAATCTGGTCAGCCTGCTGGTCAGCGTGTCCACAGGCCGTTCAAGTTC
ACCGTTGCGCTGAACAAAGCCGTGCCGCTGATGTACAACTCCCTGGCGTCCGGCGAGATGCTGCCGAAAG
TGACCCTGAAGTGGTACCGCACCTCCGTAGAGGGCAAGCAGGAGCACTTTTTCTCTACCGTGCTGACCGA
TGCCACCATCGTCGACATCGACTGCCAGATGCCGCACTGCCAGGATCCGGCGAAGTCTGACTTCACCCAG
CTGATCCAGGTCTCCATGGCCTACCGCAAGATTGACTGGGAGCACACTGTTGCCGGTACTTCCGGTGCGG
ACGACTGGCGTGCGCCGATCGAGGCGTAA