SecReT6
Protein ID: 117620760
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1844
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2012673..2014109 [+]
ProductImpA-related domain-containing protein
NoteTssA
UniProt IDA0KJC7
KEGG IDaha:AHA_1844
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-14, Aligned region: 50..108
ImpA-rel_N [PF06812], Evalue: 2.60E-14, Aligned region: 394..413
Protein Sequence: 478 a.a.     [Download]
>gi|117620760|ref|YP_856378.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MSYQHPWCARLLTSLPDEQIRGAVLADEPRWDYVETELVKLGSLAHSQVDLNAVAEACLGLLESRTKDMR
VLAQLLRCLQHPAKATPLGAAISLLEAWIQAYWLLAWPGNASQKQRLMVQIVKRFEGALPRICESASAAE
LAQLLAQAEQLERVWLAQCPDKGELLDPLVMGLKRAQRQQLAQAEANAAGQPQSSGAAAAGSPASVASTA
SCAGAMVLSGSAGVDVDSSNDRAWRQTQLKVAELLIERQPEVAVGYRLRRHAVWAGITAVPMSGAGNKTP
LAPMSADMVDEYRAAMNAPDQGLWQRIEQSLTLAPYWFEGHRLSAEVAEKLGFGAVAQAIAEELGTFLQR
LPALRELAFSDGSPFLSPECSRWLQPAKGGSAGIGEAGLAEEVAQRHGEQGIAAALALLDERIAQLKEPR
DRFHALLVQAELLAQEGMEALARQHYQHLWQEASRLGLSHWEPGLVNRLESLAAPLSK
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2012673-2014109 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGAGCTATCAACACCCCTGGTGTGCACGCCTGCTCACCAGCCTGCCGGATGAACAGATAAGAGGCGCCG
TGCTGGCCGACGAGCCGCGCTGGGACTATGTGGAGACCGAGCTGGTCAAGCTGGGATCCCTCGCTCACAG
CCAGGTCGATCTCAATGCGGTGGCCGAGGCCTGCCTCGGTTTGCTGGAGAGTCGCACCAAGGACATGCGG
GTGCTGGCCCAGTTGCTGCGCTGCCTGCAGCACCCTGCCAAGGCGACCCCGCTGGGGGCGGCGATCAGCC
TGCTGGAGGCCTGGATCCAGGCTTACTGGCTGCTGGCCTGGCCCGGCAATGCCAGCCAGAAACAGCGGCT
GATGGTGCAGATCGTCAAGCGCTTCGAAGGGGCCCTGCCGCGCATTTGCGAGAGCGCTTCGGCGGCCGAG
CTGGCCCAGCTGCTGGCCCAGGCCGAGCAGCTGGAGCGGGTCTGGCTGGCGCAGTGTCCCGACAAGGGGG
AGCTGCTCGACCCGCTGGTGATGGGGCTGAAGCGGGCCCAGCGCCAGCAGCTGGCACAGGCCGAGGCCAA
TGCCGCCGGGCAGCCCCAGAGCAGCGGCGCGGCGGCTGCGGGCTCCCCGGCCTCGGTGGCGTCGACCGCC
AGTTGTGCCGGCGCCATGGTACTCAGCGGCAGTGCTGGCGTCGACGTCGACAGTTCCAACGATCGTGCCT
GGCGTCAGACCCAGCTCAAGGTGGCGGAGCTCCTCATCGAGCGTCAGCCCGAGGTGGCGGTAGGCTATCG
GCTGCGTCGTCACGCCGTCTGGGCCGGGATCACGGCGGTCCCCATGAGCGGGGCGGGCAATAAAACCCCG
CTGGCGCCCATGTCGGCGGACATGGTGGACGAGTACCGTGCCGCCATGAACGCCCCTGATCAGGGGCTCT
GGCAGCGCATCGAACAGAGCCTGACCCTGGCACCCTACTGGTTCGAGGGGCACAGGCTTTCGGCCGAGGT
GGCCGAGAAACTCGGCTTTGGGGCGGTGGCCCAGGCGATCGCCGAGGAGCTCGGGACTTTTCTGCAGCGC
CTGCCGGCCCTGCGGGAACTCGCCTTCAGCGACGGCTCGCCGTTTCTCTCCCCCGAGTGCAGCCGCTGGC
TGCAACCGGCCAAGGGCGGCAGTGCGGGCATTGGCGAGGCGGGGCTGGCCGAGGAGGTCGCCCAGCGCCA
CGGCGAGCAGGGGATCGCGGCGGCGCTCGCCCTGCTTGATGAGCGGATTGCGCAGTTGAAAGAGCCAAGA
GATCGCTTCCACGCCTTGCTGGTGCAGGCGGAGCTGTTGGCGCAGGAAGGCATGGAGGCGCTTGCGCGCC
AGCACTATCAACACTTGTGGCAAGAGGCCAGTCGCCTCGGGTTGTCGCACTGGGAGCCCGGGCTGGTCAA
CCGCCTGGAGAGCCTGGCGGCGCCGTTGTCGAAATGA