SecReT6
Protein ID: 117621074
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1827
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]1991311..1993542 [+]
ProductVgrG protein
NoteTssI
UniProt IDA0KJB0
KEGG IDaha:AHA_1827
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-70, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 372..465
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 578..593
DUF2345 [PF10106], Evalue: 0.00016, Aligned region: 585..628
Protein Sequence: 743 a.a.     [Download]
>gi|117621074|ref|YP_856361.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MADSTGLQFTVKVGALPESTFVVAEFALDEALNRPFNLRLELASAQPDIDFGAVLDQPCELLVWYNGELQ
RRVCGVVSDFAQGDSGFRRTRYQLMVQPALWRLSLRQNCRIFQAQKPDEILSILLQEHGITDYAFALKNE
HAKREYCVQYRETDLDFVNRLAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYV
RQFHYREAVRPSDVELKDYSCKTPAYGLSHKKQGSELEHQRDTYQHFDYPGRYKQDPSGKAFAQHRLDAL
RNDAVAGQVKSNCAALLPGQTFSLTEHPNGSLNTDWQIVRIRHTGEQPQALEEEGGSGPTVYHNEFGVVK
ASTTWRARIGSPEAPHKPMVDGPQIAMVVGPDGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGW
AGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTRTVLRTETHQGEGFNELRF
EDQAGQEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRVRKVPGEEGAPPSLGNDHLTVEGEKR
DHIKADYSLTVDTSMHQKLGQSWLTQAGQEVHVKAGAKVVLEAGSEITVKVGGCFIKVDGGGVTLVGPTI
KMNSGGNAGSGSGWAGKVPKSMEGMLDSPHTRWMKFYHLDSELMPLAGTPYKAVLSDGSVREGTLDGEGM
ALLEDVPAGTASVTYDLQDTFADLPRESISALTGHLDSLSDEG
 
Nucleotide Sequence: 2232 bp     [Download]
>gi|117617447|ref|NC_008570.1|:1991311-1993542 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCTCTGCCCGAGAGCACCTTCGTGGTGG
CCGAGTTTGCGCTGGATGAAGCGCTCAACCGCCCGTTCAACCTGCGTCTGGAGCTGGCGAGTGCCCAGCC
CGACATCGACTTTGGCGCCGTGCTGGACCAGCCGTGCGAGCTGCTGGTGTGGTACAACGGCGAGCTGCAG
CGCCGGGTCTGCGGGGTGGTGAGTGACTTCGCGCAGGGTGACAGCGGCTTTCGCCGCACCCGCTATCAGC
TCATGGTGCAGCCGGCCCTGTGGCGACTCTCTTTGCGCCAAAACTGCCGCATCTTCCAGGCGCAAAAGCC
CGATGAAATCCTCTCCATCCTGTTGCAAGAGCACGGCATCACCGACTATGCCTTTGCGCTCAAGAACGAG
CATGCCAAGCGGGAGTACTGCGTTCAGTACCGGGAAACCGACCTCGATTTCGTGAACCGGCTTGCCGCCG
AAGAGGGGATGTTCTACTTCCACGAGTTTGAAGCGGGCAAGCACCGCATCGTGTTTGCCGACGACGCGGC
CGCTCTGACTGCCGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGTTCCCTCGAGCAAGGCCCCTATGTG
CGGCAGTTCCACTACCGTGAGGCAGTGCGCCCGTCGGATGTGGAGCTCAAAGACTACAGCTGCAAGACGC
CTGCCTACGGCCTCTCTCACAAAAAGCAGGGCAGTGAGCTCGAGCACCAGCGCGACACCTACCAGCACTT
CGACTATCCGGGCCGCTACAAGCAGGACCCGAGCGGCAAGGCGTTTGCCCAGCATAGGCTGGATGCGCTG
CGCAACGACGCGGTGGCGGGCCAGGTTAAGTCCAACTGCGCCGCGTTGCTGCCGGGCCAGACGTTTTCAC
TCACTGAACATCCCAACGGCAGCCTCAACACCGACTGGCAAATCGTGCGTATCCGTCACACCGGTGAACA
ACCCCAGGCCTTGGAAGAAGAAGGCGGCAGCGGCCCCACCGTCTATCACAACGAATTTGGTGTAGTGAAG
GCCAGCACCACCTGGCGGGCGCGCATCGGCAGTCCGGAGGCCCCTCACAAGCCCATGGTGGATGGCCCGC
AAATCGCCATGGTGGTGGGCCCCGACGGGGAAGAGATTTACTGCGACGAGCACGGCCGGGTGAAGCTGCA
ATTCCCGTGGGACCGCTACGGCTCGAGCAACGACCAGAGCTCCTGCTGGGTGCGAGTCTCGCAAGGCTGG
GCCGGCGGCCAATACGGCATGATGGCCATCCCGCGCATCGGCCACGAGGTCATCGTGAGCTTTTTGGAAG
GGGATCCGGACCAGCCCATCGTGACCGGGCGCACCTATCACGCCACCAATCGGCCACCGTACGAGCTGCC
AGCCAACAAGACCCGCACCGTGCTGCGCACCGAAACCCACCAGGGTGAGGGCTTCAACGAGCTGCGCTTT
GAAGACCAGGCTGGGCAGGAAGAGATTTACATCCACGGTCAGAAAGACCTGAACGTGCTGATAGAGAACG
ATGCCGCTTGGCACATCAAACATGACCAGCACACCGACATCGACAACGAGCGGGTGACCCGTGTCAGGAA
GGTGCCGGGTGAGGAAGGGGCCCCACCCAGTCTTGGCAACGATCATCTGACCGTTGAAGGAGAGAAGCGG
GACCATATCAAGGCTGACTACTCGCTGACCGTGGATACCTCCATGCATCAAAAACTCGGTCAGAGCTGGC
TCACCCAGGCGGGGCAGGAAGTGCACGTCAAAGCCGGTGCCAAGGTGGTGCTGGAAGCGGGTTCTGAAAT
TACCGTCAAGGTCGGTGGCTGCTTTATCAAGGTTGATGGCGGCGGTGTCACCCTGGTCGGCCCCACCATC
AAGATGAATTCGGGTGGCAATGCAGGCTCTGGATCTGGTTGGGCTGGCAAGGTACCCAAGAGCATGGAGG
GTATGCTGGACAGCCCTCACACACGCTGGATGAAATTTTATCACCTCGACTCCGAGCTGATGCCGCTGGC
GGGCACCCCCTACAAGGCCGTATTGAGCGATGGTTCGGTGCGGGAAGGCACGCTGGATGGTGAGGGCATG
GCGCTGCTCGAGGATGTGCCTGCTGGCACCGCCTCAGTGACCTATGACCTGCAGGACACTTTTGCCGATC
TGCCCCGTGAATCCATCTCGGCCCTCACCGGCCATCTCGACAGTCTGAGCGACGAGGGCTGA