SecReT6
Protein ID: 117621313
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1833
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]1999252..2000724 [+]
Producthypothetical protein
NoteTssC
UniProt IDA0KJB6
KEGG IDaha:AHA_1833
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.10E-191, Aligned region: 63..488
Protein Sequence: 490 a.a.     [Download]
>gi|117621313|ref|YP_856367.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MVEEQVQAGASAASSSLLDEIMAQARITPVDEGYSVAKQGVAALIANILDSGTTSDPVNKALVDSMIVEL
DKKLSKQMDVILHAKELQEMESSWRSLKLLVDRTDFRENIKIQVLHATKEELLEDFEFSPEITQSGLYKH
VYSSGYGQFGGQPVGAVIGDYAFTHSAPDIKLMQYVSAVGAMAHAPFISSVAPSFFGVDSFTDLSSIKDL
KSVFEGPAYTKWRALRESEDARYLGLTAPRFLARLPYDPTENPIKGFNYQEDISSDHDHYLWGNTAYLMG
TSLTDSFAKYRWCPNIIGPQSGGAIHDLPVHVYEAMGQLQAKIPTEVLITDRREYELSEEGFITLTMRKD
SDNAAFFSANSVQKPKVFPNTKEGREAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLERE
LNSWIRQFVADQENPPAEVRSRRPLRAAQIKVLDVEGEPGWYQVAMAVRPHFKYMGASFELSLVGRLDKE
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|117617447|ref|NC_008570.1|:1999252-2000724 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
TTGGTCGAAGAACAGGTTCAAGCGGGGGCGAGTGCTGCCTCCTCGTCCTTGCTGGACGAAATCATGGCGC
AGGCCCGCATTACCCCGGTGGATGAGGGCTACAGCGTCGCCAAGCAGGGTGTTGCAGCCCTGATCGCCAA
CATTCTGGACAGCGGCACCACCAGCGATCCGGTCAACAAGGCGCTGGTGGACAGCATGATTGTCGAGCTC
GACAAGAAGCTGAGCAAGCAGATGGACGTCATCCTGCACGCCAAGGAGCTGCAGGAGATGGAGTCCTCCT
GGCGCTCCCTGAAGCTCTTGGTGGATCGCACCGATTTTCGCGAGAACATCAAGATCCAGGTGCTGCATGC
CACCAAGGAAGAGCTGCTGGAAGATTTCGAGTTCTCACCCGAAATCACCCAGTCCGGCCTCTACAAGCAT
GTCTATTCCAGCGGTTATGGTCAGTTTGGTGGCCAGCCGGTGGGGGCAGTGATCGGTGATTACGCCTTCA
CCCACAGCGCACCCGACATCAAGCTGATGCAATACGTCAGTGCGGTGGGTGCCATGGCCCATGCGCCTTT
CATCTCCTCTGTGGCGCCATCCTTCTTCGGCGTCGACAGCTTTACCGACCTGTCCTCCATCAAGGATCTG
AAATCGGTATTCGAAGGGCCGGCCTACACCAAGTGGCGCGCCTTGCGTGAGTCGGAAGATGCCCGTTATC
TGGGACTGACCGCACCGCGCTTCCTGGCGCGTCTGCCCTACGACCCGACCGAAAACCCCATCAAGGGCTT
CAACTATCAGGAAGACATCAGCTCGGACCACGATCACTACCTGTGGGGCAACACCGCCTACCTGATGGGC
ACTTCCCTGACCGACAGCTTCGCCAAGTATCGCTGGTGCCCGAACATCATAGGCCCGCAGAGCGGTGGCG
CCATCCACGACCTGCCGGTGCACGTCTATGAGGCCATGGGTCAGCTGCAGGCGAAGATCCCGACCGAGGT
GCTGATCACCGACCGACGCGAGTACGAACTGTCGGAAGAGGGTTTCATCACCCTGACCATGCGCAAGGAC
AGCGACAACGCCGCCTTCTTCTCCGCCAACTCGGTACAAAAACCCAAGGTGTTCCCGAACACCAAGGAAG
GCCGGGAGGCGGAGACCAACTACAAGCTGGGTACCCAGCTGCCCTACATGTTCATCATCAACCGCCTGGC
GCACTACATCAAAGTGCTGCAGCGCGAGCAGATCGGCTCCTGGAAGGAGCGTCAGGATCTGGAGCGTGAG
CTGAACAGCTGGATCCGGCAGTTTGTCGCAGACCAGGAAAACCCGCCGGCAGAGGTCCGCAGCCGCCGTC
CGCTGCGCGCTGCGCAGATCAAGGTGCTGGATGTGGAAGGGGAGCCGGGCTGGTATCAGGTCGCCATGGC
CGTGCGTCCGCACTTCAAGTACATGGGGGCGAGCTTCGAGCTCTCTCTGGTAGGTCGTCTGGACAAGGAA
TAA