SecReT6
Protein ID: 117621540
SecReT6 ID157
T6SS typei1
Gene symbolclpA
Locus tagAHA_1857
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2029151..2031403 [+]
ProductATP-dependent Clp protease, ATP-binding subunit ClpA
NoteTssH
UniProt IDA0KJD7
KEGG IDaha:AHA_1857
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.30E-53, Aligned region: 205..289
AAA_2 [PF07724], Evalue: 2.30E-53, Aligned region: 383..442
AAA_2 [PF07724], Evalue: 2.30E-53, Aligned region: 483..643
AAA [PF00004], Evalue: 5.40E-24, Aligned region: 208..299
AAA [PF00004], Evalue: 5.40E-24, Aligned region: 409..449
AAA [PF00004], Evalue: 5.40E-24, Aligned region: 489..604
ClpB_D2-small [PF10431], Evalue: 1.40E-23, Aligned region: 650..730
AAA_5 [PF07728], Evalue: 8.00E-21, Aligned region: 208..286
AAA_5 [PF07728], Evalue: 8.00E-21, Aligned region: 489..605
Clp_N [PF02861], Evalue: 9.40E-14, Aligned region: 13..62
Clp_N [PF02861], Evalue: 9.40E-14, Aligned region: 96..130
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 185..231
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 251..291
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 458..521
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 552..580
Sigma54_activat [PF00158], Evalue: 9.40E-10, Aligned region: 187..287
Sigma54_activat [PF00158], Evalue: 9.40E-10, Aligned region: 489..612
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 208..294
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 374..464
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 486..585
AAA_17 [PF13207], Evalue: 3.70E-08, Aligned region: 209..258
AAA_17 [PF13207], Evalue: 3.70E-08, Aligned region: 488..522
Zeta_toxin [PF06414], Evalue: 8.60E-07, Aligned region: 207..225
Zeta_toxin [PF06414], Evalue: 8.60E-07, Aligned region: 358..430
Zeta_toxin [PF06414], Evalue: 8.60E-07, Aligned region: 487..573
AAA_18 [PF13238], Evalue: 1.70E-06, Aligned region: 209..284
AAA_18 [PF13238], Evalue: 1.70E-06, Aligned region: 490..522
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 202..269
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 487..508
AAA_6 [PF12774], Evalue: 1.20E-05, Aligned region: 490..527
AAA_3 [PF07726], Evalue: 2.50E-05, Aligned region: 208..228
AAA_3 [PF07726], Evalue: 2.50E-05, Aligned region: 489..608
TIP49 [PF06068], Evalue: 2.80E-05, Aligned region: 208..249
TIP49 [PF06068], Evalue: 2.80E-05, Aligned region: 486..513
Mg_chelatase [PF01078], Evalue: 0.00018, Aligned region: 204..246
Mg_chelatase [PF01078], Evalue: 0.00018, Aligned region: 407..428
Mg_chelatase [PF01078], Evalue: 0.00018, Aligned region: 488..510
Mg_chelatase [PF01078], Evalue: 0.00018, Aligned region: 555..650
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 263..287
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 447..513
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 554..583
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 635..675
AAA_25 [PF13481], Evalue: 0.00024, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.00024, Aligned region: 487..509
RNA_helicase [PF00910], Evalue: 0.00076, Aligned region: 209..230
RNA_helicase [PF00910], Evalue: 0.00076, Aligned region: 489..512
AAA_33 [PF13671], Evalue: 0.002, Aligned region: 208..225
AAA_33 [PF13671], Evalue: 0.002, Aligned region: 489..523
ResIII [PF04851], Evalue: 0.003, Aligned region: 192..230
ResIII [PF04851], Evalue: 0.003, Aligned region: 268..288
ResIII [PF04851], Evalue: 0.003, Aligned region: 488..505
NACHT [PF05729], Evalue: 0.0034, Aligned region: 208..235
NACHT [PF05729], Evalue: 0.0034, Aligned region: 490..510
Arch_ATPase [PF01637], Evalue: 0.0048, Aligned region: 186..221
Arch_ATPase [PF01637], Evalue: 0.0048, Aligned region: 255..298
Arch_ATPase [PF01637], Evalue: 0.0048, Aligned region: 489..507
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 205..225
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 488..527
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 615..640
Protein Sequence: 750 a.a.     [Download]
>gi|117621540|ref|YP_856388.1| clpA gene product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MLNKDLEKTLNEAFKLARDERHEFMTVEHLLLALLDNSSAHEALSSCGADVELMRKEISAFISQTTPLIP
RDDEDRETQPTLGFQRVLQRAVFHVQSSGNTEVSGANVLVAIFSEQESQAAYFLKKAEISRLDVVNFLSH
GVRKDSKPDNSSNNAESDDDVSAAQIESFATNLNQLVLEGRIDPLIGRDQELNRTIQVLCRRRKNNPLLV
GEAGVGKTAIAEGLAYRIVKGDVPEVIAGSTIYSLDMGSLLAGTKYRGDFEKRLKVLLKQIERQEGAILF
IDEIHTIIGAGAASGGQLDAANLIKPLLSNGLLRCVGSTTYQEYSQIFEKDRALARRFQKIDIVEPSVDD
TTRILMGLKSRYEAHHGVRYTVKAIRAAVELSAKYINDRHLPDKAIDVIDEAGAGQRLLPASKRKKVINV
QEIEAIVAKIARIPEKSVSSSDKEVLKNLERNLKMVVFGQDKAIEVLTDSIRLSRSGLGNERRPVGCFLF
AGPTGVGKTEVTQQLGKALGVEVLRFDMSEYMERHTVSRLIGAPPGYVGFEQGGLLTDSVLKHPHSVVLL
DEIEKAHPDVFNLLLQVMDNGTLTDNNGRKADFRNVILVMTTNAGVQETQRKSIGFQQQDMSHDAMAVIN
KTFSPEFRNRLDHTIWFNHLDMQVIHQVVDKFIVELQVQLDAKGVSLEVSEGVRHWLAEKGYDRAMGARP
MGRVIQEHLKKPLANEILFGSLVDGGGVKVELINDSLSFDYQVNVEAVSH
 
Nucleotide Sequence: 2253 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2029151-2031403 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGTTGAATAAAGATCTAGAAAAGACGCTGAACGAGGCTTTCAAACTGGCCCGTGACGAGCGCCACGAAT
TCATGACTGTCGAGCACCTGTTGTTAGCCCTGCTGGATAACAGCTCAGCCCATGAGGCGCTGAGTTCTTG
TGGTGCTGACGTGGAGCTGATGCGCAAAGAGATCAGCGCATTCATCAGTCAAACAACCCCGCTTATTCCC
CGTGACGATGAAGATCGTGAAACCCAGCCCACACTGGGCTTCCAGCGGGTGCTGCAACGCGCCGTGTTCC
ATGTCCAATCATCGGGCAACACGGAAGTCAGTGGTGCCAACGTGCTGGTTGCCATTTTCAGCGAGCAGGA
GTCCCAGGCCGCTTACTTCCTGAAAAAGGCCGAGATCAGCCGGCTGGACGTGGTCAACTTCCTCTCCCAT
GGCGTGCGCAAAGACAGCAAGCCGGACAACAGCAGCAACAATGCCGAGTCCGACGACGATGTGTCTGCCG
CCCAGATAGAAAGCTTTGCCACCAATCTCAATCAGCTGGTGCTGGAAGGGCGTATCGATCCGCTCATCGG
GCGGGATCAGGAGCTCAATCGCACCATCCAGGTGCTCTGCCGCCGTCGCAAGAACAACCCCTTACTGGTT
GGTGAAGCCGGGGTAGGCAAGACGGCTATCGCCGAAGGACTGGCTTATCGTATCGTCAAGGGCGATGTGC
CCGAGGTGATTGCGGGCAGCACCATTTATTCCCTGGACATGGGCTCGCTGCTGGCGGGGACCAAGTATCG
CGGTGATTTCGAGAAGCGCCTCAAGGTGCTGCTCAAGCAGATCGAGCGCCAGGAAGGGGCGATTCTGTTC
ATCGACGAGATCCACACCATCATAGGGGCAGGGGCGGCCTCCGGTGGTCAGCTGGACGCGGCCAACCTTA
TCAAGCCGCTGCTCTCCAATGGTTTGCTGCGCTGTGTCGGCTCCACCACCTATCAGGAATATTCCCAGAT
CTTTGAGAAGGACCGTGCTCTGGCGCGTCGCTTCCAGAAGATCGATATCGTCGAGCCCAGTGTGGATGAC
ACCACCCGCATCCTCATGGGTCTCAAGAGCCGCTATGAGGCTCACCACGGGGTGCGCTACACCGTCAAGG
CCATCCGCGCCGCGGTGGAGCTCTCTGCCAAGTACATCAATGATCGCCATCTGCCTGACAAGGCGATCGA
CGTGATCGACGAAGCCGGTGCCGGACAACGGCTGCTGCCGGCGAGCAAGCGCAAGAAAGTGATCAATGTG
CAGGAGATCGAAGCCATTGTGGCCAAGATTGCCCGCATCCCGGAGAAATCAGTCTCCTCTTCCGACAAGG
AAGTGCTGAAGAATCTGGAGCGCAACCTCAAGATGGTGGTATTTGGTCAGGACAAGGCCATCGAGGTGCT
GACCGATTCCATTCGCTTGTCACGCTCGGGCCTTGGTAATGAGCGTCGCCCGGTGGGTTGCTTCCTGTTT
GCCGGCCCGACCGGGGTGGGCAAGACCGAGGTTACTCAGCAGTTGGGCAAGGCGCTCGGCGTCGAGGTGC
TGCGTTTTGACATGTCGGAGTACATGGAACGCCACACCGTCTCTCGCCTGATCGGGGCTCCTCCCGGCTA
TGTGGGCTTTGAGCAGGGTGGACTCCTGACCGACTCGGTACTCAAGCATCCGCACTCAGTGGTGCTGCTG
GACGAGATCGAAAAAGCGCACCCGGACGTGTTCAACCTGCTGCTGCAGGTGATGGACAACGGCACCCTGA
CCGACAACAACGGGCGCAAGGCGGATTTTCGCAATGTGATCCTGGTGATGACCACCAACGCCGGCGTGCA
GGAGACCCAGCGCAAATCCATCGGCTTCCAGCAACAGGATATGAGCCATGATGCCATGGCGGTGATCAAC
AAGACGTTCAGCCCGGAGTTTCGTAACCGGCTCGATCACACCATCTGGTTCAACCATCTGGATATGCAGG
TGATACACCAGGTGGTCGACAAGTTCATCGTCGAGTTGCAGGTACAACTGGATGCCAAGGGCGTGTCTCT
TGAAGTGTCCGAGGGTGTCCGCCACTGGTTGGCCGAGAAGGGATATGACAGGGCCATGGGAGCGAGACCC
ATGGGGCGGGTCATCCAGGAACACCTCAAGAAACCCCTTGCCAATGAGATCCTGTTCGGATCCTTGGTCG
ATGGGGGGGGAGTGAAGGTTGAGTTGATAAATGACAGCCTCAGCTTTGACTATCAGGTCAATGTTGAAGC
TGTTTCCCACTAA