SecReT6
Protein ID: 117622500
SecReT6 ID155
T6SS typei1
Gene symbolaec32
Locus tagAPECO1_1772
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]243407..243886 [-]
Producthypothetical protein
NoteTssD
UniProt IDA1A7Q9
KEGG IDecv:APECO1_1772
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.90E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|117622500|ref|YP_851413.1| aec32 gene product [Escherichia coli APEC O1]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVSFTYESIN
WEHSVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|117622295|ref|NC_008563.1|:c243886-243407 Escherichia coli APEC O1 chromosome, complete genome
ATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCATGGTGACGTCACTGTCCCATGG
TCTGAGCCGTGCGCAGAATGTCAACCATCAGGAGTTGACCATCACGAAACCGGTGGACAAATCCTCCCCT
CTGCTGGGCAAGGCCATTTCAGAGAATGAATGTCTGACCTGTGATTTTGTATTCTACCGCACCAACCGCT
TTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAACGCCCGGCTCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGTCCAGGGCAGGCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAT
TGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAACGGATTTTCTAA