SecReT6
Protein ID: 117622501
SecReT6 ID155
T6SS typei1
Gene symbolaec31
Locus tagAPECO1_1771
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]243904..245403 [-]
Producthypothetical protein
NoteTssA
UniProt IDA1A7R0
KEGG IDecv:APECO1_1771
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.80E-45, Aligned region: 138..203
DUF3702 [PF12486], Evalue: 2.80E-45, Aligned region: 305..318
DUF3702 [PF12486], Evalue: 2.80E-45, Aligned region: 335..481
ImpA-rel_N [PF06812], Evalue: 8.90E-21, Aligned region: 88..148
Protein Sequence: 499 a.a.     [Download]
>gi|117622501|ref|YP_851414.1| aec31 gene product [Escherichia coli APEC O1]
MTPLTCALTWTAAQWFTRCMWIPKITRSPAVCSACSVYRIRCIKGIVMSNYALTQTIVTGSDPRALPEFS
AIREEINKANHPSQPELNWKLVESLALSIFKANGVDLHTATYYTLARTRNQGLAGFCEGAELLAAMIIHE
WDKFWPQSGPARTEMLDWFNTRTGNILRQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLL
YFVQNTRKRFEPQPRNRTDTAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQG
DTVKGFVAGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPPLQP
LETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFADLMMKKETEKQGFT
LSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINERLDGLLSRWLLLKNTGQDMATDN
RTEPVHPTH
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|117622295|ref|NC_008563.1|:c245403-243904 Escherichia coli APEC O1 chromosome, complete genome
GTGACACCTTTAACGTGCGCTTTAACGTGGACGGCGGCGCAATGGTTTACCAGGTGCATGTGGATACCGA
AGATAACCCGTTCACCGGCGGTCTGTTCAGCCTGTTCCGTTTACCGGATACGTTGTATTAAGGGGATAGT
GATGAGCAATTACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCTGCCGGAGTTCAGC
GCCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGGAAACTGGTGGAAT
CGCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACTATACGCTGGCACG
TACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGATGATCATCCACGAA
TGGGATAAATTCTGGCCGCAGAGTGGTCCGGCGCGGACTGAGATGCTGGACTGGTTCAACACCCGCACCG
GGAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACCGCACGGAACGGGC
TTTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGTGGAAAATCTGCTT
TATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGATACGGCGGCACAGA
CCATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAACCATGCCCCCCCT
ACCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAAAGCAAAACAGGGC
GACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCACTCTGGTGGTGGC
AGGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCGCCACCGTCTGGTT
GGCATCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCCGCCACTACAGCCG
CTGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTGCAACAGCAGGAAG
CCAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGAAGGGCTGGCAACA
AGCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAAACAGGGTTTCACC
CTATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACACCACTGGAGTACC
TGCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAAAAGAGATCAACGA
ACGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATATGGCAACGGATAAC
AGAACCGAACCTGTCCATCCAACTCATTGA