SecReT6
Protein ID: 117622507
SecReT6 ID155
T6SS typei1
Gene symbolaec25
Locus tagAPECO1_1765
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]254545..255891 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1A7R6
KEGG IDecv:APECO1_1765
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-142, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|117622507|ref|YP_851420.1| aec25 gene product [Escherichia coli APEC O1]
MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLTRRLDALGDFFWGFTELSINTELLAQGKIMIDRAAGCM
PDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLALPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHT
DEGDEQPVGLGQLIPRIVSGADDLSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEV
QGLLATRAADLAGRIGSPEQSGIADVAEFMMLQMLNRYQMQFTHRSQLHTLHPEAFYRDLVGLLGELMTF
TEGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATINDPTLLQSCKLV
LAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPRQLPYHEGYVYFELEKGTPAWQ
DVIKAGALALHISGSFPDLNLQLWAIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|117622295|ref|NC_008563.1|:c255891-254545 Escherichia coli APEC O1 chromosome, complete genome
ATGGCAACAATGAAAAACAAAGTGATCTGGCAGGAAGGGCTGTTTGCCCTGCCGCAGCATTTTCAGCAAC
AGCAGCGTCACTGCGAGTACCTGCTGACCCGTCGTCTGGATGCACTGGGTGATTTTTTCTGGGGTTTTAC
GGAACTCTCCATCAATACAGAACTGCTTGCCCAGGGCAAAATCATGATTGACCGTGCGGCGGGCTGTATG
CCTGACGGCACCGTATTCAGCATTCCCGACCAGGATCTGCTGCCGGAACCTTTCCAGCCGGGAACCCTTT
CATCGAAAGAGAGCCACAATATTTATCTGGCGCTGCCGGTGATAAGCGACGTGATCAATGAAATCCAGGG
GTTGCACAGCGCCGGTCAGGGTACGGAGCGTTACCGCCTCACCCATACCCGCGTCCGTGATTTTCACACT
GACGAAGGCGACGAACAGCCAGTCGGTCTGGGGCAGTTGATCCCCAGGATAGTCAGCGGCGCAGATGATC
TCAGCGCGATGGTGACTCTCCCCCTGTGCCGTATCCTCAATAAAAATGCCACCGGCGCGCTGGTGCTGGA
CAACACCTTTATTCCCACCATTCAGGCCGTCCGTGTCAGCGGGTTGCTCGGGGCATTCTCCGGCGAGGTG
CAGGGACTGCTTGCCACCCGCGCCGCTGACCTGGCCGGGCGCATTGGTTCGCCTGAACAGAGCGGGATCG
CCGATGTGGCCGAATTTATGATGTTGCAGATGCTTAACCGCTATCAAATGCAGTTCACGCATCGTTCCCA
ACTGCACACGCTGCATCCGGAAGCCTTCTACCGGGATCTGGTGGGGCTGCTGGGAGAACTGATGACCTTT
ACCGAAGGTAATCGCCTGCCCTGCACCGTGGAGCCGTATAATCACCGGGATCTTACCGCGACCTTCACCA
GAACCGTGATCCCGGAACTGCGGCGCGCGCTCAATACCGTACTGGTGCCGCGTGCGCAGAATCTGCCGTT
GTTCTTTTCAGAGGGGACCTGGATCGCCACCATCAACGATCCCACATTGTTGCAGTCCTGCAAGCTGGTA
CTGGCAGTGCGCGCCAGGATGCCCTACGACCAGGTACAACGCCAGTTCATCCAGCAGTCGAAAGTGGCCG
CTACCGACAAAATCCGCAGCGTGGTCAGCGTGCAGGTGCCGGGTATTCCGCTGCACACGCTTACCGCTGC
GCCACGTCAGTTGCCATACCACGAAGGTTATGTTTACTTCGAACTGGAAAAAGGCACCCCGGCCTGGCAG
GACGTGATAAAAGCGGGCGCACTGGCGCTGCATATCTCCGGCAGCTTCCCCGATCTGAACCTCCAGCTCT
GGGCTATAAGGGGATAA