SecReT6
Protein ID: 117622513
SecReT6 ID155
T6SS typei1
Gene symbolaec18
Locus tagAPECO1_1759
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]261002..262486 [-]
Producthypothetical protein
NoteTssC
UniProt IDA1A7S2
KEGG IDecv:APECO1_1759
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-183, Aligned region: 67..491
Protein Sequence: 494 a.a.     [Download]
>gi|117622513|ref|YP_851426.1| aec18 gene product [Escherichia coli APEC O1]
MSVKEEIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYGQFGGEPVAAVIGNFAFKNTTPDMKLLKYISQVSAMAHSPFLSSVSSEFFGLDSWTELPG
IKEPGAIFEGPAYSRWRALRESEDSRYLGLTAPRFLLRHPYSPDENPVKTFRYHEDVSQSHESYLWGNTS
FLLAANLAESFAKYRWCPNIIGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLT
MRKGSDNACFFSANSVQKPKTFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSD
LERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMGASFDLSLVGR
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|117622295|ref|NC_008563.1|:c262486-261002 Escherichia coli APEC O1 chromosome, complete genome
ATGTCAGTAAAGGAAGAAATTGCTCCCGTCAGCGCGTCTCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAAGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCG
TATTACAAGCATGTATATTCAAGCGGTTACGGACAATTTGGCGGTGAGCCAGTGGCGGCGGTAATCGGCA
ACTTTGCCTTTAAGAACACCACGCCGGATATGAAGCTGCTGAAATATATCAGCCAGGTCAGCGCGATGGC
GCACAGCCCGTTCCTGTCGTCAGTATCATCCGAATTTTTCGGTCTGGATTCATGGACAGAGTTACCGGGG
ATCAAAGAACCGGGTGCCATCTTTGAAGGCCCGGCCTACTCCCGCTGGCGCGCCCTGCGTGAATCGGAAG
ATTCCCGTTACCTGGGCCTGACCGCCCCCCGGTTCCTGCTGCGCCACCCTTACTCACCGGATGAAAACCC
TGTCAAAACCTTCCGTTACCATGAAGATGTCAGCCAGAGTCATGAGTCTTATCTGTGGGGGAATACCTCG
TTTTTACTGGCCGCCAACCTGGCGGAAAGTTTTGCTAAGTATCGCTGGTGCCCAAATATTATTGGCCCTT
CCAGCGGCGGCGCAGTCAAAGACCTCCCGGTGCATCTGTATGAATCCATGGGGCAAATGCAGGCAAAAAT
TCCGACTGAAGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGGAAGAGGGCTTTATCACACTGACC
ATGCGTAAAGGGTCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGTGCAGAAACCCAAAACATTCCCCA
AAACCCCCGAAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACCCAGCTGCCATACTTGTTTGTTAT
CAGCAGGTTAGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTGGCTCATGGAAAGAACGTAGTGAC
CTGGAGCGTGAGCTGAACACCTGGATTCGCCAGTATGTTGCTGACCAGGAAAATCCGCCTGCCGAAGTCC
GCAGCCACCGGCCTTTGCGTCAGGCTAAGATCGAGGTACTGGATGTGGATGGTGAGCCGGGCTGGTACCA
GGTCGCGATTTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTTTCGACCTGAGCCTGGTCGGACGA
CTGGATAAGGAATAA