SecReT6
Protein ID: 117622514
SecReT6 ID155
T6SS typei1
Gene symbolaec17
Locus tagAPECO1_1758
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]262509..263012 [-]
Producthypothetical protein
NoteTssB
UniProt IDA1A7S3
KEGG IDecv:APECO1_1758
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-48, Aligned region: 10..162
Protein Sequence: 167 a.a.     [Download]
>gi|117622514|ref|YP_851427.1| aec17 gene product [Escherichia coli APEC O1]
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIAINRYNLNAVI
SEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAF
RAQLQALLENEDTREQLIQELGIAVQK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|117622295|ref|NC_008563.1|:c263012-262509 Escherichia coli APEC O1 chromosome, complete genome
ATGAGCAAAATGAACAACAATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAA
AAGTTGATGGGGTGGCTGCTGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAA
ACCAGATAACACGCCGTTGGATGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATT
TCAGAAGCTGACATTGAACGGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGT
ACGTCAACCTGAAAGTCAAATCTATGGATGACCTTTCTCCTGACCATATTGCCAGCCAGGTACCAGAAAT
AAAACGTCTGCTCGAATTGCGTGAAGCCCTAGTCGCACTTAAGTCTCCACTAGGCAATATTCCAGCCTTC
CGCGCACAACTTCAGGCGCTACTGGAAAACGAAGACACCCGCGAGCAGCTGATCCAGGAACTGGGTATCG
CCGTTCAGAAATAA