SecReT6
Protein ID: 117625042
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3717
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3117722..3119266 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1AF01
KEGG IDecv:APECO1_3717
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-172, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|117625042|ref|YP_854030.1| unnamed protein product [Escherichia coli APEC O1]
MLMSVQQEHSTSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLL
SCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELL
DISKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHM
PFIGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANPGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFA
VPHFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3117722-3119266 Escherichia coli APEC O1 chromosome, complete genome
ATGCTGATGTCTGTACAACAAGAACATTCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCG
GCGTTTATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTCTCTTCCATTCAGGAAATAGATTTATG
GCAAAACAGCGAAACGCTGGCTGATGCCTCACCCGATGAGCGCGTGACAGCAGCGATTCACGTTCTGCTT
TCCTGTCTGGCGAAATCAGGCGAGGACGTGGTTAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACG
ATCTGGATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTC
GCTGTGGCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTG
GATATCAGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATC
GTCATACATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGA
ATTTGATAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATG
CCTTTTATCGGTTCCGTCGGACCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAG
ATATCGGCAACTACTTTGACCGCGCAGAATATATTAAATGGAAGTCGTTCCGCGATACGGATGACAGCCG
CTATGTGGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGC
AGCTTTAACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTACCTGTGGACAAACGCCTCGTTCG
CCTTTGCCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGTGTGCAGATCCGTGGTCCACAGGC
AGGTGGCGCAGTAGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCG
TCCGAAGTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCCTGGCTTTATTCCGCTCTCTTATT
ATAAGAATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCCGCCCAGAAACCGGCGTTGTATGATACCGC
TGACGCCACCGCCAACAGCCGTATTAACGCCCGTCTGCCTTACATCTTCCTGCTGTCCCGCATTGCGCAT
TACCTGAAAATCATTCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGA
ACACCTGGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCT
GCGCGACGGCAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCC
GTGCCGCATTTCCAGATTGAAGGGATGGATATCAACCTTTCTCTGGTTTCCCAGATGCCGAAAGCGAAAG
CCTGA