SecReT6
Protein ID: 117625046
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3713
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3123006..3123497 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDA1AF05, A1AF05
KEGG IDecv:APECO1_3713
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|117625046|ref|YP_854034.1| unnamed protein product [Escherichia coli APEC O1]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNTTLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3123006-3123497 Escherichia coli APEC O1 chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCGGAGTTTAAATTCTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTATTTCAATACCACGCTGGATAACGTCAAGCTGGTCAGAGTAGCTCCGCT
GATGCACGACATCAAAGATCCGGGTAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA