SecReT6
Protein ID: 117625051
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3708
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3130580..3131413 [+]
Producthypothetical protein
NoteTli4 (i)
UniProt IDA1AF10
KEGG IDecv:APECO1_3708
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 277 a.a.     [Download]
>gi|117625051|ref|YP_854039.1| unnamed protein product [Escherichia coli APEC O1]
MVKCHTLINRRNKCLLIVFIVLIGWIIFRPKAYTYSLNDKEKEMLIMLSQHPETRYFGFYSIELPADYKP
TGMVMFIQGSAMIPVETKLQYYPPFLQYMTRYEAELKNTSALDPLDTPYLKQVHPLSPPMNGVIFERMKA
KYTPDFARVLDAWKWENGVTFSVKIEAKDGRATRYDGISKIAEYSYGYNIPEKKVQLLTILSGLQPRADN
QPPSENKLAIQYAQVDASLLGEYELSVDYKNSNNIKISLQTDNNSYIDSLLDIRYPSNGNRAWYNSI
 
Nucleotide Sequence: 834 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3130580-3131413 Escherichia coli APEC O1 chromosome, complete genome
ATGGTAAAATGTCATACTCTGATTAACCGTAGAAATAAATGTCTGCTGATTGTTTTTATAGTCCTTATTG
GATGGATTATATTCAGACCTAAAGCATATACTTATTCACTAAATGATAAAGAAAAAGAGATGCTCATAAT
GTTATCACAACATCCTGAAACTCGGTACTTTGGATTTTATTCCATAGAACTTCCGGCTGATTACAAACCA
ACAGGAATGGTTATGTTCATACAAGGATCGGCGATGATCCCTGTAGAAACAAAGCTACAATATTATCCTC
CTTTTCTGCAATATATGACACGATATGAGGCAGAACTAAAAAACACCTCAGCATTAGATCCACTGGATAC
GCCTTATTTGAAGCAAGTTCACCCACTAAGTCCACCTATGAATGGAGTCATTTTTGAACGAATGAAAGCG
AAATACACCCCAGATTTTGCACGAGTATTGGATGCATGGAAATGGGAAAATGGCGTTACGTTTTCAGTAA
AAATAGAAGCTAAAGATGGTAGAGCAACCCGCTATGATGGAATTAGTAAGATTGCCGAATACAGTTATGG
ATATAATATTCCAGAAAAAAAAGTACAGTTACTTACTATTCTTTCAGGACTACAACCTCGTGCAGATAAC
CAACCCCCATCAGAAAATAAATTGGCGATACAATATGCACAGGTTGACGCTTCACTACTTGGAGAGTATG
AATTATCTGTAGATTATAAAAATAGCAATAATATTAAAATAAGTTTGCAGACGGATAATAATAGTTATAT
TGACTCATTATTAGATATAAGATATCCGAGTAATGGAAACAGAGCATGGTATAACTCTATATAA