SecReT6
Protein ID: 117625056
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3702
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3139452..3141089 [+]
Producthypothetical protein
NoteTssA
UniProt IDA1AF15
KEGG IDecv:APECO1_3702
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.90E-20, Aligned region: 76..135
Protein Sequence: 545 a.a.     [Download]
>gi|117625056|ref|YP_854044.1| unnamed protein product [Escherichia coli APEC O1]
MRKSMGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNK
LSGTDTGLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFTAWPEDQHSPSLMPLINALESRLAQSGGMN
AVVPQNSSSVTAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVAIDPARAAVLCDTQHKD
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3139452-3141089 Escherichia coli APEC O1 chromosome, complete genome
ATGCGGAAGAGTATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AGACACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATACGCGACGAAATGAACAAA
CTTTCCGGCACAGATACCGGCCTTATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCCAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACT
GGCGCTGCTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGTCCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCACTGCATGGCCCGAAGACCA
GCATTCCCCCTCCCTGATGCCACTGATTAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAAC
GCGGTGGTGCCGCAAAACAGCAGCAGCGTTACTGCACCGTCATCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACCTCCGGGCGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGAT
GTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGCT
GGATATCCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCTGTT
ATCCGTCAGGACCTGGCGTTACTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCA
CGCCGTTCGCCGATGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGCGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CGGCACGACAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAA
CTGCTGTTTGAAGTAAAAGCCCGGCAACTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAG
CCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTGGCAATCGATCCGGCACGGGCAGCGGT
ACTGTGTGATACGCAACATAAGGACTGA