SecReT6
Protein ID: 117625061
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3697
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3146095..3147174 [+]
Producthypothetical protein
NoteTssG
UniProt IDA1AF20
KEGG IDecv:APECO1_3697
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.70E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|117625061|ref|YP_854049.1| unnamed protein product [Escherichia coli APEC O1]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQKAPLGSTDNPAADAVRFRPHPGMGFPVSELKNV
ERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFVTQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3146095-3147174 Escherichia coli APEC O1 chromosome, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAAAGCGCCGCTGGGCAGTACCGACAACCC
CGCCGCCGATGCGGTGCGTTTTCGCCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGTGGACAATCCCGACGCGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCACCGCTGCCCACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTGTCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCCGTGGATGACATTTCCCGTTGTCTGCTGGGGTTAATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCTGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
CACCCGCACGGCTGAAGGCGTCACGGCACTGGTGGGGCTGCTTGCCCCGCTGACGAAAGCCACGGTGGTG
CCTCACGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGTACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGGCGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA