SecReT6
Protein ID: 117625062
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3696
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3147155..3147691 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA1AF21
KEGG IDecv:APECO1_3696
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.10E-36, Aligned region: 19..168
Protein Sequence: 178 a.a.     [Download]
>gi|117625062|ref|YP_854050.1| unnamed protein product [Escherichia coli APEC O1]
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLST
MVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPD
EKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3147155-3147691 Escherichia coli APEC O1 chromosome, complete genome
ATGTTTCCTATTCGTTTTAAACGTCCGGCGTTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGTGGCT
GCGGGCTGATTCAGAAAGTGGTGGATGAATCGAAAAGCGTGGCCTCAGCCGTTTTCTACAAACAAATCAA
AATACTGCATCTCGATTTCTTCTCCCGCAGCGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACG
ATGGTGCATGTCTGGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTACGACACCCTGTTTATGC
AGGAAGAGAAGACGCTGGAGAAGGACGTACTGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGC
ATCCCTGAATGTGCCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGAT
GAAAAAAGCGACAGCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTG
AACTGATGAGAAGCGACCTGCGACTGCTGCCTCTCAAGGATAAATAA