SecReT6
Protein ID: 117625063
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3695
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3147695..3148123 [+]
Producthypothetical protein
NoteTssE
UniProt IDA1AF22
KEGG IDecv:APECO1_3695
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-17, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|117625063|ref|YP_854051.1| unnamed protein product [Escherichia coli APEC O1]
MSTPSLYEMLTFSFSGELPLEQISERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMAAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3147695-3148123 Escherichia coli APEC O1 chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCGCTGGAACAGATCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGCCGGGCAGGCAC
GCTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGGATGGCTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACACTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AATTACTCCCCCAGCCCCGTCCGGGGCATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTATTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGG
GCGTACTGA