SecReT6
Protein ID: 118497894
SecReT6 ID158
T6SS typeii
Gene symbol-
Locus tagFTN_1314
StrainFrancisella novicida U112
Repliconchromosome [GenBank: NC_008601] [Browse all T6SS(s) in this replicon]
Location [Strand]1386652..1387173 [+]
Producthypothetical protein
NoteIglG
UniProt IDA0Q7H5, Q7X3I5
KEGG IDftn:FTN_1314
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 9.00E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|118497894|ref|YP_898944.1| hypothetical protein FTN_1314 [Francisella novicida U112]
MLNIINDSLKRLEEITTDDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSTGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISGGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|118496615|ref|NC_008601.1|:1386652-1387173 Francisella novicida U112 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGGAAGAAATAACGACCGATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAACGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATACCCACGAACCCTACTACACTACTAGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTGGTGGACAAATAAATGTAAAAACATCTTAG