SecReT6
Protein ID: 119385167
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2440
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2442469..2445216 [-]
ProductATPase
NoteTssH
UniProt IDA1B4T3
KEGG IDpde:Pden_2440
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.30E-40, Aligned region: 647..813
AAA [PF00004], Evalue: 2.90E-18, Aligned region: 236..368
AAA [PF00004], Evalue: 2.90E-18, Aligned region: 653..775
AAA_5 [PF07728], Evalue: 6.50E-13, Aligned region: 236..256
AAA_5 [PF07728], Evalue: 6.50E-13, Aligned region: 652..771
AAA_16 [PF13191], Evalue: 6.30E-10, Aligned region: 64..91
AAA_16 [PF13191], Evalue: 6.30E-10, Aligned region: 213..258
AAA_16 [PF13191], Evalue: 6.30E-10, Aligned region: 281..314
AAA_16 [PF13191], Evalue: 6.30E-10, Aligned region: 447..477
AAA_16 [PF13191], Evalue: 6.30E-10, Aligned region: 621..697
ClpB_D2-small [PF10431], Evalue: 7.00E-10, Aligned region: 820..894
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 235..317
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 346..396
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 555..585
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 650..683
Sigma54_activat [PF00158], Evalue: 1.70E-06, Aligned region: 217..250
Sigma54_activat [PF00158], Evalue: 1.70E-06, Aligned region: 652..752
IstB_IS21 [PF01695], Evalue: 3.20E-05, Aligned region: 222..261
IstB_IS21 [PF01695], Evalue: 3.20E-05, Aligned region: 652..672
Arch_ATPase [PF01637], Evalue: 4.50E-05, Aligned region: 214..255
Arch_ATPase [PF01637], Evalue: 4.50E-05, Aligned region: 288..348
Arch_ATPase [PF01637], Evalue: 4.50E-05, Aligned region: 649..664
Arch_ATPase [PF01637], Evalue: 4.50E-05, Aligned region: 722..734
Clp_N [PF02861], Evalue: 6.80E-05, Aligned region: 41..87
NACHT [PF05729], Evalue: 8.70E-05, Aligned region: 236..265
NACHT [PF05729], Evalue: 8.70E-05, Aligned region: 653..679
AAA_14 [PF13173], Evalue: 9.30E-05, Aligned region: 236..317
AAA_14 [PF13173], Evalue: 9.30E-05, Aligned region: 651..733
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 52..80
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 236..261
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 650..674
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 236..302
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 654..683
AAA_25 [PF13481], Evalue: 0.00024, Aligned region: 218..260
AAA_25 [PF13481], Evalue: 0.00024, Aligned region: 649..678
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 236..257
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 651..692
AAA_17 [PF13207], Evalue: 0.00041, Aligned region: 236..256
AAA_17 [PF13207], Evalue: 0.00041, Aligned region: 652..687
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 228..252
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 649..677
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 236..271
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 563..592
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 651..676
RNA_helicase [PF00910], Evalue: 0.0046, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.0046, Aligned region: 653..674
RNA_helicase [PF00910], Evalue: 0.0046, Aligned region: 750..771
Protein Sequence: 915 a.a.     [Download]
>gi|119385167|ref|YP_916223.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTTVTPRAPARGSRETVKRKELVGRLDPLCLRAFSDGARNAKARGNPYVELVHFIAALAGMPDSDLSLIA
AAAGVDAARLEGDLARALDALPRGASAVEEFSDHIFHAIQEGWTLAALEGGTDRVRSGDILVACLKTPVL
EGLLLRISPEFGRIDPDRMAPDLPGILAGSAEAEGTAPPEMAPANVPKPPEGALAKYATNLTERARAGKI
DPVVGRDPEIRQIIDILMRRRQNNPILTGEAGVGKTAVVEGFALRLARGDVPPQLAAVDLWLLDIGLMQA
GASVKGEFEKRLKSVIDEVQASVKSVILFIDEAHTLIGAGGAAGTGDAANLLKPALARGELRTVAATTWA
EYKQHIEKDPALTRRFQVVKVEEPSEAAAVEMLRGVAGVLEKHHRVEILDEAIGAAVSLSHRYIPARQLP
DKAISLLDTACARVAVSQHATPAELEDLERRLQALEIEAGIIAREAAIGIDTTERQAANDAARTATEAER
AAALERWEAEKALVSDILTLRAELRGEGMALDETGANEAGADTDGADRLPPASAETEAADPPDTAARLAL
LRTKMAELAERQGERPLILPSVDRLAVGAVVQDWTGIPLGRMLASQTERALGLAGLLAQRVVGQDHAMAT
IASRIQTGMAGLGAPEKPMGVFMLCGPSGVGKTETALALADALYGGEQNLISINMSEFQEAHTVSTLKGA
PPGYVGYGKGGVLTEAVRRRPYSVILLDEVEKAHPDVHEIFFQVFDKGMMDDSEGRRIDFRNTLILMTSN
VGTDEIMALTDAGRTRVEIDSLSAALRPPLLKVFPPALLGRLVTIPYLPLSDAMIEAIAGQKLAGIGRRL
AAAHGAELVIGAGVMEQIRARCTEVESGGRMIDAILTGAILPELSRRVLDARLEGRGIGRVTVTGGPDGF
GYALD
 
Nucleotide Sequence: 2748 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c2445216-2442469 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGACGACCGTGACGCCCCGCGCCCCCGCCAGAGGTTCCAGAGAGACGGTCAAGCGCAAGGAGCTGGTCG
GCCGGCTGGACCCGCTGTGCCTGCGGGCGTTTTCCGACGGCGCGCGCAACGCCAAGGCGCGCGGCAATCC
TTATGTCGAGCTGGTGCATTTCATTGCCGCGCTGGCCGGGATGCCGGATTCGGACCTGTCGCTGATCGCC
GCGGCGGCCGGGGTCGACGCCGCCCGGCTGGAGGGCGACCTGGCCCGGGCGCTGGACGCCCTGCCGCGTG
GCGCCAGCGCGGTCGAGGAGTTTTCCGACCACATCTTTCACGCCATCCAGGAGGGCTGGACCCTGGCCGC
GCTGGAGGGCGGCACCGATCGGGTGCGTTCGGGCGACATCCTGGTCGCCTGCCTCAAGACCCCGGTGCTG
GAGGGGTTGCTGCTGCGCATCAGCCCGGAGTTCGGCCGCATCGACCCCGACCGCATGGCGCCGGACCTGC
CCGGCATCCTGGCCGGCTCGGCCGAGGCGGAGGGGACGGCCCCGCCCGAGATGGCGCCGGCCAACGTGCC
GAAACCGCCCGAGGGGGCGCTGGCGAAATACGCCACCAACCTGACCGAGCGGGCGCGGGCCGGCAAGATC
GACCCGGTGGTCGGCCGCGACCCGGAAATCCGCCAGATCATCGACATCCTGATGCGGCGGCGGCAGAACA
ACCCGATCCTGACCGGCGAGGCAGGGGTGGGCAAGACCGCCGTGGTCGAGGGCTTTGCCCTGCGGCTGGC
GCGCGGCGACGTGCCGCCGCAACTGGCCGCGGTCGATCTGTGGCTGCTGGACATCGGGCTGATGCAGGCC
GGCGCCAGCGTCAAGGGCGAGTTCGAAAAGCGGCTGAAATCGGTGATCGACGAGGTGCAGGCTTCGGTGA
AATCGGTGATCCTGTTCATCGACGAGGCGCATACGCTGATCGGTGCCGGCGGCGCGGCGGGAACGGGCGA
TGCCGCGAACCTGCTGAAACCCGCGCTGGCGCGGGGCGAGTTGCGCACCGTCGCCGCCACCACCTGGGCC
GAATACAAGCAGCATATCGAAAAGGATCCGGCGCTGACCCGGCGCTTTCAGGTGGTGAAGGTCGAGGAGC
CATCGGAGGCGGCCGCCGTCGAGATGCTGCGCGGCGTGGCGGGCGTGCTGGAAAAGCACCACCGGGTCGA
GATCCTGGACGAGGCGATCGGGGCCGCGGTTTCGCTGTCGCATCGCTATATCCCGGCGCGGCAATTGCCG
GACAAGGCGATCAGCCTTCTCGACACCGCCTGCGCCCGCGTCGCCGTCAGCCAGCACGCCACGCCCGCCG
AGTTGGAGGATCTGGAGCGTCGCCTGCAGGCGCTGGAGATCGAGGCGGGCATCATCGCCCGCGAGGCCGC
CATCGGGATCGACACGACCGAGCGCCAGGCCGCCAACGACGCCGCCCGCACCGCGACGGAGGCCGAGCGC
GCGGCCGCGCTGGAACGCTGGGAGGCGGAAAAGGCGCTGGTCTCGGACATCCTGACCTTGCGGGCCGAGT
TGCGCGGCGAGGGCATGGCACTGGACGAGACGGGGGCGAACGAGGCGGGGGCGGATACGGACGGCGCTGA
TAGGTTGCCCCCAGCCTCTGCGGAAACCGAGGCGGCCGACCCCCCCGACACCGCCGCGCGGCTGGCACTT
TTGCGCACCAAGATGGCCGAACTGGCCGAAAGGCAGGGTGAGCGGCCCTTGATCCTGCCCTCGGTGGACC
GGCTGGCGGTGGGGGCGGTGGTGCAGGACTGGACCGGCATCCCGCTGGGCCGGATGCTGGCCAGCCAGAC
CGAGCGCGCGCTGGGCCTTGCGGGCCTGCTCGCGCAGCGCGTCGTCGGTCAGGACCATGCCATGGCCACC
ATCGCCAGCCGCATCCAGACCGGCATGGCCGGGCTGGGCGCGCCGGAAAAGCCGATGGGCGTCTTCATGC
TCTGCGGTCCCTCGGGCGTCGGCAAGACCGAGACCGCGCTGGCGCTGGCCGACGCGCTTTACGGCGGCGA
GCAGAACCTGATTTCCATCAACATGAGCGAGTTCCAGGAGGCGCATACCGTCTCGACCCTCAAGGGCGCG
CCGCCGGGCTATGTCGGCTATGGCAAGGGCGGCGTGCTGACCGAGGCGGTGCGGCGCCGGCCCTATTCGG
TGATCCTGCTCGACGAGGTGGAAAAGGCCCATCCCGACGTGCACGAGATCTTTTTCCAGGTCTTCGACAA
GGGGATGATGGACGACAGCGAGGGGCGGCGGATCGACTTTCGCAACACGCTGATCCTGATGACCTCGAAT
GTCGGCACCGACGAGATCATGGCGCTGACCGATGCCGGCCGCACCCGGGTCGAGATCGACAGCCTGTCGG
CCGCGCTGCGCCCGCCCTTGCTGAAGGTGTTTCCCCCGGCGCTGCTGGGGCGGCTGGTGACGATTCCCTA
CCTGCCGCTTTCGGATGCGATGATCGAGGCCATCGCCGGGCAGAAGCTGGCCGGCATCGGCCGCAGGCTG
GCCGCCGCGCATGGCGCCGAACTGGTGATCGGCGCGGGAGTCATGGAGCAGATCCGCGCCCGCTGCACCG
AGGTCGAATCGGGCGGCCGCATGATCGACGCCATCCTGACCGGCGCGATCCTGCCCGAACTCAGCCGCCG
GGTGCTGGATGCCAGGCTGGAAGGGCGCGGCATCGGCAGGGTGACGGTGACCGGCGGGCCGGACGGCTTC
GGCTATGCGCTGGACTGA