SecReT6
Protein ID: 119385169
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2442
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2447625..2448755 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA1B4T5
KEGG IDpde:Pden_2442
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-17, Aligned region: 52..111
ImpA-rel_N [PF06812], Evalue: 2.50E-17, Aligned region: 218..226
Protein Sequence: 376 a.a.     [Download]
>gi|119385169|ref|YP_916225.1| unnamed protein product [Paracoccus denitrificans PD1222]
MFLAPLSVPDSAGSDLRNDMRFLALARALDGASRATRAEQLAKGNTGDVALDWAHLLDEAEALAQTGRDL
RLLVIVARIMTNMRGPEGLAEGLDLLAGTLETWWDHLHPALREGQLVREAALRRINALYQIENADAGILG
DLEFNTMLAPRGLPVVSGGDLAAGTVTPSVLAAEGPTGLSAAEQAERAALHDARVTRVLTACRASRDMEP
EAVAGLEAGLAASLEALARLETALAARIGDDPPTRFPALRRLLERMAATLASPQAQFSHAAQPAAQAETD
APAAPPAPMPAPAAVPFASVSAGLPARLATRAEVETCLDLIIDFYDRNEPASPLPHLARRMKKMVPMNFL
QLMEELAPGGMKEFRNVAGVAEDKGR
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2447625-2448755 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGTTTCTCGCCCCGCTTTCCGTGCCGGATTCCGCCGGATCGGATCTTCGCAACGACATGAGATTTCTGG
CTCTCGCGCGGGCGCTGGACGGGGCCTCTCGGGCGACCCGGGCCGAGCAGCTGGCCAAGGGCAATACCGG
CGACGTGGCGCTGGACTGGGCGCATCTGCTGGACGAGGCCGAGGCGCTGGCCCAGACCGGCCGCGACCTG
CGCCTGCTGGTCATCGTGGCACGGATCATGACCAACATGCGCGGCCCCGAGGGACTGGCCGAGGGGCTGG
ACCTGCTGGCCGGCACGCTGGAGACTTGGTGGGACCACCTGCACCCCGCCTTGCGGGAAGGCCAGCTTGT
GCGCGAAGCCGCGCTGCGCCGCATCAACGCGCTTTACCAGATCGAGAATGCCGATGCGGGGATCCTGGGC
GATCTGGAGTTCAATACCATGCTTGCCCCGCGCGGCCTGCCGGTGGTCTCGGGCGGGGATCTGGCGGCGG
GCACGGTCACGCCCTCGGTCCTGGCCGCCGAGGGGCCGACCGGCCTTTCCGCCGCCGAACAGGCCGAGCG
CGCGGCGCTTCATGACGCAAGGGTGACGCGGGTGCTGACCGCCTGCCGCGCCTCGCGCGACATGGAGCCC
GAGGCGGTGGCGGGGCTGGAGGCAGGGCTTGCCGCCTCGCTGGAGGCGCTCGCCCGGCTGGAAACGGCCC
TGGCCGCCCGCATCGGGGACGACCCGCCGACCCGCTTTCCGGCGCTGCGGCGGCTGCTGGAGCGGATGGC
GGCGACGCTGGCCAGCCCGCAGGCCCAGTTCAGCCATGCCGCGCAGCCGGCGGCGCAGGCGGAAACCGAC
GCACCCGCGGCGCCCCCCGCCCCGATGCCCGCACCTGCGGCCGTTCCCTTCGCGTCCGTATCAGCGGGCC
TGCCGGCAAGGCTGGCCACACGCGCCGAGGTCGAGACCTGTCTCGACCTCATCATCGATTTCTACGACCG
CAACGAACCTGCCTCGCCGCTGCCGCATCTGGCGCGGCGGATGAAGAAGATGGTGCCGATGAACTTCCTG
CAACTGATGGAGGAACTGGCGCCTGGAGGAATGAAGGAATTCCGCAATGTCGCCGGAGTGGCCGAGGACA
AGGGACGCTGA