SecReT6
Protein ID: 119385170
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2443
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2448813..2449355 [+]
Producthypothetical protein
NoteTssB
UniProt IDA1B4T6
KEGG IDpde:Pden_2443
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-52, Aligned region: 9..170
Protein Sequence: 180 a.a.     [Download]
>gi|119385170|ref|YP_916226.1| unnamed protein product [Paracoccus denitrificans PD1222]
MSESKAKVIERNRAPRVQIAYDVEHYGSPTTIELPFVMGVMADLAGKSTSREAQKPPAERSFVEVDAGRF
PAFMEALSPRVTARIPNRLPRKEGEEAGEEEMFVDLTFRNMGDFAPDRIAEQVPELAELMKMRRKLEELL
SYMDGKASAEKRIAQLLNDEPLLARVAEQAVTPGSDETEG
 
Nucleotide Sequence: 543 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2448813-2449355 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGAGCGAGAGCAAGGCCAAGGTAATCGAACGCAATCGCGCCCCAAGGGTGCAGATCGCCTATGACGTCG
AGCATTACGGCAGCCCGACCACCATCGAACTGCCCTTCGTCATGGGGGTGATGGCGGATCTGGCGGGCAA
GTCCACCTCGCGCGAGGCGCAGAAACCGCCCGCCGAACGATCCTTCGTCGAGGTGGATGCCGGCCGCTTT
CCCGCCTTCATGGAGGCGCTTTCGCCCCGCGTCACCGCCCGCATCCCGAACCGCCTGCCCCGCAAGGAGG
GCGAGGAGGCCGGCGAGGAAGAGATGTTCGTGGACCTGACCTTTCGCAACATGGGCGATTTCGCCCCCGA
CCGCATCGCCGAGCAGGTCCCCGAACTGGCCGAACTGATGAAGATGCGCCGCAAGCTTGAGGAACTGCTG
AGCTATATGGACGGCAAGGCCAGCGCCGAAAAGCGCATCGCCCAGCTTCTGAACGACGAACCGCTGCTGG
CCCGCGTCGCCGAGCAGGCGGTGACCCCCGGCAGCGACGAGACGGAGGGCTGA