SecReT6
Protein ID: 119385171
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2444
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2449359..2450873 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1B4T7
KEGG IDpde:Pden_2444
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-176, Aligned region: 70..499
Protein Sequence: 504 a.a.     [Download]
>gi|119385171|ref|YP_916227.1| unnamed protein product [Paracoccus denitrificans PD1222]
MAEQELKGAGAAPEAEAVDLDEFGTLLEKDFRVKEQDDSAKLRELVANLALAAREKAGSATISGNAVRSI
KSLIAGIDELLTAQMNEVLHAPEIRRMEGSWRGLHYLVNNTETDTMLKIRVLNITKDELADQLEDFEGQM
WDQSPMFRKLYTEEYSSFGGAPFGSIVGDYEFSHHPRDVGLLRNLSGICASAHAPFIAAASPRLFRMESW
QELPNPQDLKMVTSSPDYAAWQSLRESEDARYIGLTLPRVLARLPYGPDTIPVKGFDFREEIDGRHDHYV
WMNAAFPMGVNINRSHKLYGWGSQIRGVESGGAVTNLPVHTFPSDDGSVVMKCPTEIAIDDRREHELAKL
GLMPILHRKNTDVAAFLGAQTLQDCEARAGRLVDPDAQANERLSANLPYLLPVCRFAHYLKAIARDKIGT
FKERADMEVWLSEWINRYVLANTAMADDKAKAKRPLAKAEVQVDSVEGRPGYYAARFYLRPHYQLEGINA
SLRLVSELPSVKGP
 
Nucleotide Sequence: 1515 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2449359-2450873 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGCCGAACAGGAACTCAAGGGCGCCGGGGCCGCACCCGAAGCCGAAGCCGTCGATCTGGACGAATTCG
GCACGCTTCTGGAAAAGGATTTCCGCGTCAAGGAACAGGACGACAGCGCCAAGCTGCGCGAACTGGTCGC
GAACCTGGCCCTTGCCGCCCGCGAAAAGGCCGGCAGCGCCACGATCTCGGGCAATGCCGTGCGCTCGATC
AAGTCGCTGATCGCCGGCATCGACGAACTTCTGACCGCGCAGATGAACGAGGTGCTGCACGCCCCCGAGA
TCCGCCGCATGGAGGGAAGCTGGCGCGGGCTGCACTATCTGGTGAACAACACCGAAACCGACACCATGCT
CAAGATCCGGGTGCTGAACATCACCAAGGACGAGCTTGCCGACCAGCTCGAGGATTTCGAGGGGCAGATG
TGGGACCAGTCGCCCATGTTCCGCAAGCTCTATACCGAGGAATATTCCAGCTTCGGCGGCGCCCCCTTCG
GCAGCATCGTCGGCGATTACGAATTCAGCCACCATCCGCGCGACGTGGGGCTGCTGCGCAACCTGTCGGG
GATCTGCGCCTCGGCCCATGCGCCCTTCATCGCGGCGGCCTCGCCCCGGCTGTTCCGCATGGAAAGCTGG
CAGGAACTGCCCAATCCGCAGGACCTGAAGATGGTCACCTCCTCGCCCGATTACGCGGCCTGGCAAAGCC
TGCGCGAAAGCGAGGATGCGCGCTATATCGGCCTGACCCTGCCGCGCGTGCTGGCGCGGCTGCCCTATGG
GCCGGACACCATCCCGGTCAAGGGCTTCGACTTCCGCGAGGAAATCGACGGCAGGCACGACCATTACGTC
TGGATGAACGCGGCCTTTCCCATGGGGGTGAACATCAACCGCAGCCACAAGCTGTACGGCTGGGGCAGCC
AGATCCGCGGCGTGGAATCGGGCGGCGCGGTCACCAACCTGCCGGTGCATACCTTCCCCAGCGACGACGG
TTCGGTGGTGATGAAATGCCCGACCGAGATCGCCATCGACGACCGGCGCGAGCACGAGTTGGCCAAGCTG
GGGCTGATGCCGATCCTGCATCGCAAGAACACCGATGTCGCGGCATTCCTGGGCGCGCAGACCTTGCAGG
ATTGCGAGGCCCGCGCCGGGCGGCTGGTCGATCCCGACGCCCAGGCCAACGAGCGGCTGTCAGCCAACCT
GCCCTATCTGCTGCCGGTCTGCCGCTTCGCGCATTACCTCAAGGCCATCGCCCGCGACAAGATCGGCACC
TTCAAGGAACGCGCCGACATGGAGGTCTGGCTGTCGGAATGGATCAACCGCTATGTGCTGGCAAACACCG
CCATGGCCGACGACAAGGCCAAGGCCAAGCGCCCGCTGGCCAAGGCCGAGGTCCAGGTGGACAGCGTCGA
GGGCCGGCCCGGCTATTACGCCGCCCGCTTCTACCTGCGCCCGCATTACCAGCTGGAAGGGATCAACGCC
TCGCTGCGGCTGGTCTCGGAACTGCCCTCGGTCAAGGGGCCGTGA