SecReT6
Protein ID: 119385173
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2446
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2451532..2452278 [+]
Producthypothetical protein
NoteTssE
UniProt IDA1B4T9
KEGG IDpde:Pden_2446
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-21, Aligned region: 97..228
Protein Sequence: 248 a.a.     [Download]
>gi|119385173|ref|YP_916229.1| unnamed protein product [Paracoccus denitrificans PD1222]
MASPAPDRPRTSVPLQARRDEVQPSLWDRLIDDLPALSAEIARREAALTARHGAARLQALLSGEGRDGLD
ADQARELAALAQLQARHAALQERGILVTPDVLREAVRRDIEDLFGIERLEVRYLLTPAERRAAPPGIAGG
AEDPAEMLADFPHVRASVLNYGVPAFAGRRAGDFDHEALARELREVLAVFEPRLRRDTIRIAVEPGTRVG
LRVHIEGLLLMAPAPERLRLLTTIDLDTGAAATVLEEG
 
Nucleotide Sequence: 747 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2451532-2452278 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGCCAGCCCCGCCCCCGACCGCCCCCGCACCTCCGTGCCCCTCCAGGCGCGGCGCGACGAGGTGCAGC
CCAGCCTGTGGGACCGGCTGATCGACGACCTGCCCGCACTGTCGGCCGAGATCGCCCGGCGCGAGGCGGC
CCTGACCGCCCGCCACGGCGCCGCGCGCTTGCAGGCGCTGCTGTCGGGCGAGGGGCGCGACGGGCTGGAC
GCCGACCAGGCGCGCGAACTCGCGGCGCTGGCGCAATTGCAGGCCCGCCACGCCGCCTTGCAGGAACGCG
GCATCCTCGTCACCCCGGACGTGCTGCGCGAGGCGGTGCGCCGCGACATCGAGGATCTGTTCGGCATCGA
GCGGCTGGAGGTGCGCTATCTGCTGACCCCGGCCGAGCGCCGCGCCGCGCCCCCCGGCATCGCCGGCGGC
GCCGAGGATCCGGCCGAGATGCTGGCCGATTTTCCCCATGTCCGTGCCTCGGTCCTGAATTACGGCGTGC
CCGCCTTTGCCGGGCGGCGCGCGGGCGATTTCGACCACGAGGCGCTGGCGCGCGAATTGCGCGAGGTGCT
GGCGGTGTTCGAGCCGCGCCTGCGCCGCGACACCATCCGCATCGCGGTCGAGCCCGGCACCCGTGTCGGC
CTGCGCGTGCACATCGAGGGGCTTTTGCTGATGGCCCCGGCGCCCGAGCGGCTGCGGCTGCTGACCACCA
TCGACCTGGACACGGGTGCCGCCGCAACGGTGCTGGAGGAGGGCTGA