SecReT6
Protein ID: 119385174
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2447
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2452278..2454140 [+]
Producthypothetical protein
NoteTssF
UniProt IDA1B4U0
KEGG IDpde:Pden_2447
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-158, Aligned region: 5..618
Protein Sequence: 620 a.a.     [Download]
>gi|119385174|ref|YP_916230.1| unnamed protein product [Paracoccus denitrificans PD1222]
MDRAFLAAYEAELDHIRVLAGEFAALHPNVARNLSLDAVPCPDPYVERLLEGVAFLAARTRMKVEAEGQR
LTAGVMDALWPDLAAPGPAMGIGVLQPGPQVQAMAGGHPVPRGSRFTAAVREGLATRATYATAQAVTLWP
LALGTADYLPDLGALAAAGLAAPGAEAGIRIGLHATGPTALSALALDRLDLCFAGSARAGALFDAIFGGG
LGALARPARPGAVALPLARPDLVGTGDDEGLTPRLRRSFEGFRLLRDYFLMPERFHYLRLDGLAPAARQC
GEGVTLELALPLARPQPLLEGLGRDDFRLFATPLVNLFEKECNFVELDPRATAHPVHPDRARTRDFEVYR
LIRVADADREGQDGLLCPAHAPEAPRHAGPVWWTERRPRRPATDEIRRGQMRSSHAGHDLWISVSRADGR
MPHRLDIRALCTNRDLPILDDTPRLTPEGGEPVMRVDLLGPMRRPQPALAGAPPQAGQGGTAGLDDLTWR
LVAQLASGHLSLAEAGRDGAPLCALLALYADRGDPRLARHARAVAAVSSRPVIERLELPGPLALGRGTEI
TLEIDEAPLAGASRLLLPALLDRLFARHASVNAFVRTRTRLVQKQEEMSWPMRPGLRARI
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2452278-2454140 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGACCGCGCCTTCCTTGCCGCCTACGAGGCCGAACTGGACCATATCCGGGTGCTGGCCGGCGAATTCG
CCGCCCTGCATCCCAACGTGGCGCGCAACCTGTCGCTGGACGCCGTGCCCTGCCCCGACCCCTATGTCGA
GCGGCTGCTGGAGGGCGTGGCCTTCCTGGCCGCCCGCACGCGGATGAAGGTCGAGGCCGAGGGCCAGCGT
CTCACCGCCGGGGTGATGGACGCGCTTTGGCCCGACCTGGCCGCGCCGGGGCCGGCCATGGGCATCGGCG
TGCTGCAACCCGGCCCGCAGGTGCAGGCCATGGCGGGCGGGCATCCGGTGCCGCGCGGCAGCCGCTTCAC
CGCCGCCGTGCGCGAAGGGCTGGCCACCCGCGCCACCTATGCCACCGCGCAGGCGGTGACGCTCTGGCCG
CTGGCGCTGGGGACGGCGGACTACCTGCCCGACCTTGGCGCGCTGGCCGCCGCGGGCCTTGCCGCGCCGG
GGGCCGAGGCGGGCATCCGCATCGGCCTGCACGCGACGGGACCGACCGCGCTGTCGGCGCTGGCGCTGGA
CCGGCTCGACCTGTGCTTTGCCGGCAGCGCGCGGGCGGGGGCGCTGTTCGACGCGATCTTCGGCGGCGGC
CTCGGGGCGCTGGCGCGGCCCGCCCGGCCGGGGGCGGTCGCGCTTCCCCTCGCCCGGCCCGACCTGGTGG
GCACCGGCGACGACGAGGGGCTGACCCCGCGCCTGCGCCGCAGCTTCGAGGGCTTCCGGCTGCTGCGCGA
CTATTTCCTGATGCCGGAACGCTTTCACTACCTGCGGCTGGACGGGCTCGCGCCCGCCGCCCGGCAATGC
GGCGAAGGCGTGACGCTGGAGCTTGCCCTGCCGCTTGCCCGCCCCCAGCCGCTGCTGGAGGGGCTGGGCC
GGGACGATTTCCGGCTGTTCGCCACGCCGCTGGTCAACCTGTTCGAGAAAGAGTGCAATTTCGTCGAACT
CGATCCGCGGGCCACGGCGCATCCGGTCCATCCCGACCGCGCCCGCACCCGCGATTTCGAGGTCTATCGC
CTGATCCGCGTCGCCGATGCCGACCGCGAGGGGCAGGACGGGCTGCTCTGTCCCGCCCATGCCCCCGAGG
CGCCGCGCCATGCCGGCCCGGTCTGGTGGACCGAGCGCCGCCCCCGCCGCCCGGCCACCGACGAGATCCG
GCGCGGCCAGATGCGCAGCTCCCATGCCGGGCACGACCTGTGGATCTCGGTCTCGCGCGCGGACGGGCGG
ATGCCGCACCGGCTGGACATCCGCGCGCTTTGCACCAATCGCGACCTGCCGATCCTGGACGACACGCCGC
GGTTGACCCCCGAGGGCGGCGAGCCGGTGATGCGGGTCGATCTGTTGGGCCCGATGCGCCGACCCCAGCC
AGCACTGGCAGGCGCGCCGCCGCAGGCGGGCCAGGGCGGCACCGCGGGCCTGGACGACCTGACCTGGCGG
TTGGTGGCGCAGCTTGCCTCGGGCCATCTGTCGCTGGCCGAGGCCGGGCGCGACGGCGCACCGCTTTGCG
CGCTGCTGGCGCTTTACGCCGATCGCGGCGATCCGCGGCTTGCCCGCCACGCCCGCGCCGTCGCCGCAGT
ATCGAGCCGCCCGGTGATCGAGCGGCTGGAGCTGCCCGGCCCGCTGGCCCTCGGCCGCGGCACCGAGATC
ACGCTGGAGATCGACGAGGCCCCGCTGGCCGGGGCCAGCCGGCTGCTCTTGCCGGCGCTGCTCGACCGGC
TGTTCGCCCGGCACGCCTCGGTCAACGCCTTCGTGCGCACCCGCACCCGCCTTGTCCAGAAACAGGAGGA
GATGTCATGGCCGATGCGGCCCGGCCTGCGCGCCCGGATCTGA