SecReT6
Protein ID: 119385175
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2448
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2454104..2455141 [+]
Producthypothetical protein
NoteTssG
UniProt IDA1B4U1
KEGG IDpde:Pden_2448
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-82, Aligned region: 19..325
Protein Sequence: 345 a.a.     [Download]
>gi|119385175|ref|YP_916231.1| unnamed protein product [Paracoccus denitrificans PD1222]
MADAARPARPDLTGNPPPPAGIEAFALMRRLESPGRRFGHAGGPEQEPARLGQEIRLGPAACEVARFSPA
EGDAPARIALEITGLFGPEGPMPLHLSRRMLERMSERWFAGSALPEPGADRAFLEFCNLLQHRMMALYYR
AFAEAQPAIAADHGREGRLSAMIAALAGLGLPGTAEALDDPAPALRHATGLASQIRSPETLAALLSDLLD
APVRVAEFVPYWQEIPATLASRLGRTHAGLGRGAMLGPRAYQPQARAEIVVGPLTLAQYRRLIEDGPARA
ALRRLLRFVMGEEIGFDLRLVLAAPEVPAPTLGLGPALGQTGWLGGGAGRDRDDLRLPLDERQAA
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2454104-2455141 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGCCGATGCGGCCCGGCCTGCGCGCCCGGATCTGACGGGGAACCCGCCCCCACCCGCCGGCATCGAGG
CCTTCGCCCTGATGCGGCGGCTGGAATCGCCCGGCCGCCGCTTCGGCCATGCCGGCGGCCCCGAGCAGGA
GCCCGCGCGGCTGGGGCAGGAAATCCGCCTGGGCCCCGCCGCCTGCGAGGTCGCGCGCTTCAGCCCCGCC
GAAGGCGACGCCCCCGCCCGCATCGCGCTGGAGATCACCGGGCTTTTCGGCCCCGAAGGCCCGATGCCGC
TGCATCTGAGCCGCCGCATGCTGGAACGCATGTCCGAACGCTGGTTCGCCGGCTCCGCCCTGCCGGAACC
GGGGGCGGATCGCGCCTTCCTGGAGTTCTGCAACCTGCTCCAGCACCGGATGATGGCGCTTTACTATCGC
GCCTTTGCCGAGGCCCAGCCCGCCATCGCCGCCGATCACGGGCGCGAGGGCAGGCTTTCGGCGATGATCG
CGGCGCTGGCCGGCCTCGGCCTGCCCGGCACCGCCGAGGCGCTGGACGATCCCGCGCCTGCCCTGCGCCA
CGCCACCGGGCTGGCCAGCCAGATCCGCAGCCCCGAGACGCTGGCGGCGCTGCTGTCGGACCTGCTGGAC
GCGCCGGTGCGGGTGGCGGAATTCGTGCCGTATTGGCAAGAGATCCCCGCCACCCTGGCCAGCCGACTCG
GCCGTACCCATGCCGGGCTGGGCCGGGGCGCGATGCTGGGTCCGCGGGCCTATCAGCCGCAGGCCCGGGC
CGAGATCGTCGTCGGCCCGCTGACGCTTGCGCAATACCGCAGGCTGATCGAGGACGGGCCGGCAAGGGCG
GCGCTGCGCCGCCTGCTGCGCTTTGTCATGGGCGAAGAGATCGGCTTCGACCTGCGGCTGGTGCTGGCCG
CGCCCGAGGTGCCGGCGCCCACGCTGGGGTTGGGGCCGGCGTTGGGACAGACCGGCTGGCTGGGCGGGGG
TGCGGGGCGGGACCGCGACGACCTGCGCCTGCCGCTGGATGAAAGGCAGGCCGCCTGA