SecReT6
Protein ID: 119385176
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2449
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2455141..2456376 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA1B4U2
KEGG IDpde:Pden_2449
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.00E-12, Aligned region: 28..95
Protein Sequence: 411 a.a.     [Download]
>gi|119385176|ref|YP_916232.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTLRLTILASPVPQPQTELRLDSGRAELGREPGCDWQIDDPEMFVSRRHCIVEATAEGWTVTDTSTGGLF
LDGAAEPLGPGRSAALRDGMRLRLGDVTLGVTVETGAQAAAAPDQGIGIDPFFAPRDPAPPPPPRPLELP
EPFERTTGRFAPQPPPAPPPGFDDPFMLDPLPAAPPATPPQAGDDWSWGPAGASPPRPEPVPVMSAALPD
SPPPAAPQPQPPSDAAAAFLRGAGLDPASVEGVDIEALGRRYRMLAEGLVALLRARAEEKGSLRVARTTL
GAAQVNPLKFLAMPDEQVAALIAPRGSGYLDPDDAIAEAFRDLADHRMRSWHGLQAALRRMIDRFSPEAI
EAQLADAGLLRALLAGGRSALLWDAYAARWAEIARAAEDRFLGEVGAEFRDAYETPDRSEP
 
Nucleotide Sequence: 1236 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2455141-2456376 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGACCCTGCGCCTCACCATCCTTGCAAGCCCCGTTCCCCAGCCCCAAACCGAATTGCGGCTGGACAGCG
GCCGGGCGGAGCTGGGGCGCGAGCCGGGCTGCGACTGGCAGATCGACGACCCCGAGATGTTCGTCTCGCG
CCGCCATTGCATCGTCGAGGCCACGGCCGAGGGCTGGACCGTCACCGATACCAGCACCGGCGGGCTGTTC
CTCGACGGGGCGGCCGAGCCGCTGGGACCGGGCCGCAGCGCCGCGCTGCGCGACGGAATGCGGCTGCGGC
TGGGCGACGTCACTCTGGGCGTGACCGTCGAGACCGGGGCGCAGGCAGCGGCGGCACCCGACCAAGGCAT
CGGGATCGACCCGTTCTTCGCGCCCCGCGATCCGGCACCGCCGCCGCCGCCGCGCCCGCTGGAACTGCCC
GAACCCTTCGAGCGCACGACCGGCCGTTTCGCCCCGCAACCGCCGCCCGCGCCGCCGCCGGGCTTCGACG
ATCCCTTCATGCTGGACCCGCTGCCCGCCGCACCGCCTGCAACGCCGCCCCAGGCGGGCGACGATTGGAG
CTGGGGACCGGCGGGCGCATCGCCGCCCCGGCCCGAACCCGTGCCTGTCATGTCAGCCGCTCTGCCGGAT
TCCCCTCCCCCTGCCGCCCCGCAACCGCAGCCGCCATCCGACGCGGCCGCCGCCTTCCTGCGCGGCGCCG
GGCTGGACCCGGCAAGTGTCGAAGGTGTCGACATCGAGGCGCTTGGCCGCCGCTACCGGATGCTGGCCGA
GGGGCTGGTCGCATTGCTGCGCGCGCGGGCCGAGGAAAAGGGCTCGTTGCGCGTCGCCCGCACCACGCTG
GGCGCGGCACAGGTCAACCCGTTGAAATTCCTTGCCATGCCCGACGAACAGGTGGCCGCGCTGATCGCGC
CGCGCGGGTCGGGCTATCTGGACCCCGACGACGCCATCGCCGAGGCGTTCCGCGACCTTGCCGACCACCG
GATGCGCAGCTGGCACGGCTTGCAGGCCGCGCTGCGCCGCATGATCGACCGCTTCTCGCCCGAGGCGATC
GAGGCGCAGCTGGCCGATGCCGGGCTGCTGCGGGCGCTGCTGGCGGGCGGGCGCTCGGCGCTGCTTTGGG
ACGCCTATGCCGCCCGCTGGGCCGAGATCGCCCGCGCCGCCGAGGACCGCTTCCTGGGCGAGGTCGGCGC
CGAATTCCGCGATGCCTACGAAACCCCTGACAGGAGCGAGCCATGA