SecReT6
Protein ID: 119385177
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2450
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2456373..2456846 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA1B4U3
KEGG IDpde:Pden_2450
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-25, Aligned region: 21..148
Protein Sequence: 157 a.a.     [Download]
>gi|119385177|ref|YP_916233.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTTILPILTRRATLAGLGTLALTAACGGPTGPGSVNLAMSASAGVNPGPDGSDRPLTLHILQLRGTAGFD
AADPLALQDPATALGADLVKAETVTLAPGSSAEKALVLDPATTAVAVVAGYRNPAGKTTRAKAAVSPTGT
ASFTVTAGPGGVTMTPA
 
Nucleotide Sequence: 474 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2456373-2456846 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGACAACGATCCTTCCCATCCTCACGCGCCGGGCCACGCTGGCCGGGCTTGGAACGCTGGCGCTGACCG
CGGCCTGCGGCGGGCCGACCGGTCCCGGCTCGGTCAACCTGGCCATGTCGGCCTCGGCCGGGGTCAATCC
CGGCCCCGACGGCAGCGACCGGCCGCTGACGCTGCACATCCTGCAATTGCGCGGCACCGCCGGCTTCGAC
GCCGCCGATCCGCTGGCGCTGCAAGATCCAGCAACCGCCCTGGGGGCCGATCTGGTCAAGGCCGAGACGG
TGACCCTGGCGCCCGGCAGCAGCGCCGAAAAGGCGTTGGTGCTGGATCCGGCGACGACCGCGGTGGCGGT
GGTCGCCGGCTATCGCAACCCGGCCGGCAAGACCACGCGCGCCAAGGCCGCCGTCTCGCCCACCGGCACC
GCCAGCTTCACCGTCACCGCCGGGCCGGGCGGCGTCACGATGACACCAGCCTGA