SecReT6
Protein ID: 119385178
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2451
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2456858..2458192 [+]
Producthypothetical protein
NoteTssK
UniProt IDA1B4U4
KEGG IDpde:Pden_2451
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-116, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|119385178|ref|YP_916234.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTEGSRVFWSEGLFLRPQHFQQQDRHAAAQLRALLRARPRQAWGFVALRLDPSALEAGQVAIAEAEGLFP
DGTAFRIPADSPAPPPVAVGRATPAGAVLLGVAPRQPGTAAVDPAHAEPGGARWRGEWTSLRDEIRGGTE
PAEVEIARLSTRLFLPGEATQGAVTLPLAGIEGLAADGRVALAEGWLPPALTLAAVPWYAGLLKELVTGL
DRIIEAQGGMVLGGGGRSVENLLILELANAARPRLQHLLAQNLAHPSELFADLAELAGRMATYGSSTRRL
SPLPDYDHADPQPGFAALADALRSLILSLRHVEPKSRALPVARHAQNVWKVRIDNPEILQNSRIVLRIGS
DMSDEGLMQLFTRQVTVGAAEEFETLWTSRLPGIPLRPLHSQPREIPYDGDRLCLELDRKSEHWARLQAS
PGFVLGVSGKLDREPEIDCYAVSR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2456858-2458192 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGACCGAAGGCAGCCGCGTCTTCTGGTCCGAGGGCCTGTTCCTGCGCCCGCAGCATTTCCAGCAGCAGG
ACCGCCATGCCGCGGCCCAGTTGCGCGCGCTGCTGCGGGCGCGGCCGCGGCAGGCATGGGGCTTTGTCGC
GCTGCGGCTGGACCCCTCGGCGCTGGAGGCCGGGCAGGTCGCCATCGCCGAGGCCGAGGGGCTGTTCCCC
GACGGCACCGCCTTTCGCATCCCGGCCGACAGCCCGGCGCCGCCGCCGGTCGCGGTCGGCCGCGCGACGC
CCGCCGGCGCGGTCCTTCTGGGCGTGGCGCCGCGCCAGCCCGGCACGGCGGCGGTCGATCCCGCCCATGC
CGAGCCGGGCGGCGCGCGCTGGCGCGGTGAATGGACCAGCCTGCGCGACGAGATCCGCGGCGGCACCGAG
CCCGCCGAGGTCGAGATCGCCCGGCTTTCGACCCGGCTGTTCCTGCCCGGCGAGGCCACGCAGGGCGCCG
TCACCCTGCCCTTGGCCGGGATCGAGGGGCTGGCCGCCGACGGCCGGGTCGCCTTGGCCGAGGGCTGGCT
GCCCCCCGCGCTGACGCTGGCCGCCGTGCCCTGGTATGCCGGGCTGCTCAAGGAACTGGTCACCGGGCTG
GACCGCATCATCGAGGCGCAGGGCGGCATGGTGCTGGGCGGCGGCGGCCGCTCGGTCGAGAACCTGCTGA
TCCTGGAGCTGGCCAACGCCGCCCGGCCAAGGCTGCAACACCTGCTCGCGCAGAACCTTGCGCACCCGTC
CGAGCTTTTCGCCGACCTGGCCGAGCTGGCGGGGCGGATGGCGACCTATGGTTCCTCGACCCGGCGGCTG
TCGCCGCTGCCCGATTACGATCATGCCGACCCGCAGCCGGGTTTCGCCGCGCTGGCGGATGCGCTGCGCT
CGCTGATCCTGTCCCTGCGTCATGTCGAGCCGAAATCCCGCGCCCTGCCGGTCGCGCGTCACGCGCAGAA
CGTCTGGAAGGTGCGCATCGACAATCCCGAGATCCTGCAGAACAGCCGCATCGTGCTGCGCATCGGCTCG
GACATGTCTGACGAGGGGCTGATGCAGCTTTTCACCCGCCAGGTCACCGTGGGCGCGGCCGAGGAGTTCG
AGACGCTGTGGACCTCGCGCCTGCCGGGCATTCCCCTGCGGCCGCTGCATTCGCAGCCGCGCGAGATCCC
CTATGACGGCGACCGGCTGTGCCTGGAGCTGGACCGTAAGTCCGAGCACTGGGCACGGCTGCAAGCCTCG
CCGGGCTTCGTGCTGGGCGTGTCCGGCAAGCTGGACCGCGAACCCGAAATCGACTGCTACGCGGTCAGCA
GATAG