SecReT6
Protein ID: 119385179
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2452
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2458202..2459593 [+]
ProductOmpA/MotB domain-containing protein
NoteTssL
UniProt IDA1B4U5
KEGG IDpde:Pden_2452
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-51, Aligned region: 66..271
OmpA [PF00691], Evalue: 7.10E-16, Aligned region: 352..453
Protein Sequence: 463 a.a.     [Download]
>gi|119385179|ref|YP_916235.1| unnamed protein product [Paracoccus denitrificans PD1222]
MGGDPNDPFGLGDPGRTRIRPLGAGRPQSQPDPPGPMLPRPAWQAPPDPVAPEAAPHARRGRAHPNPLVA
AHATLLELAPELERANPPARPDALRARLQSVLVEGRDASVAAGTPLSRADQGAWFVAALLDDLALNTPWG
GQSDWPRQPLVTQMTGEVDAGTRFFDRLDTLMRNPAGERDLLELAWLCLCLGFRGKYRVQGGAGEGALVA
LRAQIARLLRDPEREAAPLAPHGAGVVAPDTPRRFAVPLWTLWLGALGLVLAIHTGLSMHLSGKAESLFT
QAAGLPPPDRAAIFRPVRQTVEPAPELPATVIDPLLPAFEAALPAALRPAMKGRETSGLVVLVVRASDPE
VFRSAKASLNPAYQPLVEAIGRTVVANAHRIGAVAVSGHTDNVPVQRSNPFASNQGLSEARAETVAQALA
AAGVPAELISAEGRADSQPVGDNATRDGRAQNRRIEIRIEKRQ
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2458202-2459593 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGGCGGCGATCCGAACGATCCCTTCGGCCTCGGCGACCCCGGCCGCACCCGGATCCGCCCCTTGGGCG
CGGGCCGGCCGCAATCCCAGCCCGATCCGCCCGGTCCGATGCTGCCGCGCCCCGCCTGGCAGGCGCCGCC
CGATCCCGTCGCGCCCGAGGCCGCGCCCCATGCCCGGCGCGGGCGGGCGCATCCCAACCCGCTGGTCGCC
GCCCATGCCACGCTGCTGGAACTGGCGCCCGAGCTTGAGCGCGCCAATCCCCCCGCCCGCCCCGATGCGC
TGCGGGCGCGGCTGCAATCGGTGCTGGTCGAGGGGCGCGACGCCTCGGTCGCCGCCGGCACGCCGCTGAG
CCGGGCCGACCAGGGCGCCTGGTTCGTCGCCGCCCTGCTGGACGACCTGGCACTGAACACGCCCTGGGGC
GGGCAAAGCGACTGGCCCCGGCAGCCCTTGGTGACGCAGATGACCGGCGAGGTCGATGCCGGCACCCGCT
TTTTCGACCGGCTGGACACGCTGATGCGCAACCCGGCGGGCGAGCGCGACCTGCTGGAACTGGCGTGGCT
GTGCCTCTGCCTGGGCTTTCGCGGCAAGTATCGCGTGCAGGGCGGCGCCGGCGAAGGCGCGCTGGTGGCG
CTGCGCGCGCAAATCGCCCGGCTGCTGCGCGACCCGGAACGCGAGGCCGCGCCGCTGGCCCCGCATGGCG
CCGGAGTGGTCGCGCCGGATACGCCGCGCCGATTCGCGGTGCCGCTGTGGACGCTGTGGCTGGGGGCGCT
TGGGCTGGTCCTGGCGATCCATACGGGCCTCTCGATGCATCTGTCGGGCAAGGCGGAAAGCCTGTTCACC
CAGGCCGCCGGCCTGCCGCCGCCCGACCGCGCCGCGATCTTCCGCCCGGTCCGCCAGACCGTCGAGCCGG
CCCCGGAACTGCCGGCAACCGTGATCGACCCGCTGCTGCCCGCATTCGAGGCCGCACTGCCCGCCGCCCT
GCGCCCGGCCATGAAGGGGCGCGAGACCTCGGGCCTCGTGGTGCTGGTGGTGCGGGCCAGCGACCCCGAA
GTGTTCCGCTCGGCCAAGGCCAGTCTCAACCCGGCCTATCAGCCGCTGGTCGAGGCGATCGGCAGGACCG
TCGTCGCCAATGCCCATCGCATCGGCGCGGTCGCGGTCAGCGGCCATACCGACAACGTGCCGGTGCAGCG
CAGCAATCCCTTCGCCTCGAACCAGGGGCTGTCCGAGGCGCGGGCCGAAACCGTCGCGCAGGCGCTGGCG
GCGGCCGGCGTGCCCGCCGAACTCATCAGCGCCGAGGGCCGCGCCGACAGCCAGCCGGTGGGCGACAACG
CCACCCGCGATGGCCGCGCTCAGAACCGCCGGATCGAGATCCGCATCGAGAAGAGGCAATAG