SecReT6
Protein ID: 119385182
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2455
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2463608..2465959 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1B4U8
KEGG IDpde:Pden_2455
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-72, Aligned region: 27..328
Phage_base_V [PF04717], Evalue: 9.00E-23, Aligned region: 208..224
Phage_base_V [PF04717], Evalue: 9.00E-23, Aligned region: 373..465
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 508..529
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 527..546
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 547..570
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 574..593
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 596..613
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 616..633
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 639..650
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 652..673
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 667..690
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 675..693
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 703..715
Gp5_C [PF06715], Evalue: 2.30E-13, Aligned region: 767..777
Protein Sequence: 783 a.a.     [Download]
>gi|119385182|ref|YP_916238.1| unnamed protein product [Paracoccus denitrificans PD1222]
MSSAREITVAIPAIGEPVTFERMEGEEQVSAPFAFELRFSARTLDLKPADLLGTRATIAVKGAEDSEPRH
FDGHVAEFGLAEIRDDFAFYRLLLRPALWFASLATDNRIFQNLSVPDIIEEVLRAYPDVVLDKRLEGSYP
PRDYCVQFEESDLDFLQRLMEEEGIFYFFEHGEDGHVTVLADANAAMKPVPGAEEIAYEPDSPSAPREGD
YLTGWVPRASVRIGGFAQTDYDFLKPSSDLMATASRPEGHAGDRREAYLYPGRHLELGRGDRLAGIRLEE
AQAAFERVAAEGTARPPGPGRSFTLTGFPREAENDRHLVLSARYRMWDDQVRAGQRAGQEGRDPLGYHVR
LVCAPARIPFRPERRTPRRPMRGPQTAVVVGPAGAEIYTDEHARVKVQFFWDRKGRRDAHSSCFVRVSQT
WAGAGWGFIQIPRIGQEVIVDFLDGDADRPIVTGRVYNAEQVPPYGLPGNATQSGWKSNSSPGGGGWNEL
RFEDKAGAEEVYFQAQKDHNELIKNDETRRIGHDWIEDVGNDATQSIGNDRRESVGHDKFTTIDANRQVS
IGVDDTEKVGGHRSLDVGATETIHVAASSTEAIDGAHSQTVGGVQTITVKAARVDSVAATETRNVGAAQT
NTIVGARAVTVLAGQNHAITSDDGWKVGGNRSTNVAGNETVEVAGNRSHKAGGNRVEKISGDSTLDVAGK
RGTTVGADELHKVGGKMALDVGAALAIVAADSISLTCGSAAIVLKKDGTITIEGKDIMIKGSGKIDVKAS
GETSVKGSKVNLN
 
Nucleotide Sequence: 2352 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c2465959-2463608 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGTCATCCGCCCGCGAGATCACCGTCGCCATCCCCGCCATCGGCGAGCCCGTCACCTTCGAGCGCATGG
AGGGCGAGGAACAGGTCTCGGCCCCCTTCGCCTTCGAGCTGCGCTTCTCGGCCAGGACGCTGGACCTCAA
GCCGGCCGATCTGCTGGGCACCCGCGCCACCATTGCCGTCAAGGGGGCCGAGGACAGCGAGCCGCGGCAT
TTCGACGGCCATGTCGCCGAGTTCGGCCTGGCCGAGATCCGCGACGACTTCGCCTTTTACCGGCTGCTTC
TGCGCCCGGCGCTGTGGTTCGCGAGCCTCGCGACCGACAACCGCATCTTCCAGAACCTTTCGGTGCCCGA
CATCATCGAGGAGGTGCTGCGCGCCTATCCCGACGTGGTGCTGGACAAGCGGCTGGAGGGCAGCTACCCG
CCGCGCGACTATTGCGTCCAGTTCGAGGAAAGCGACCTCGACTTCCTTCAGCGGCTGATGGAGGAGGAGG
GGATCTTCTATTTCTTCGAGCATGGCGAGGACGGCCATGTCACCGTGCTGGCCGATGCCAATGCGGCGAT
GAAGCCCGTGCCGGGCGCCGAAGAGATCGCCTATGAGCCCGACAGCCCCAGCGCGCCGCGCGAAGGCGAC
TACCTGACCGGCTGGGTGCCGCGCGCCTCGGTGCGGATCGGGGGTTTTGCGCAGACCGATTACGATTTCC
TCAAGCCATCCTCGGACCTGATGGCGACGGCGAGCCGGCCCGAGGGCCATGCCGGCGACCGGCGCGAGGC
TTACCTTTATCCCGGCCGCCATCTGGAGCTGGGGCGCGGCGACCGTCTGGCCGGCATCCGGCTGGAAGAG
GCGCAGGCCGCCTTCGAGCGCGTCGCGGCCGAGGGCACCGCCCGTCCGCCGGGACCGGGGCGCAGCTTCA
CCCTGACGGGTTTCCCGCGCGAGGCCGAGAACGACCGCCATCTGGTGCTGTCCGCCCGCTATCGCATGTG
GGACGATCAGGTCCGCGCCGGCCAGCGCGCCGGGCAGGAGGGGCGCGATCCGCTGGGCTATCACGTCCGG
CTGGTCTGCGCCCCGGCCCGCATCCCCTTTCGCCCCGAGCGCCGTACGCCGCGCCGGCCGATGCGCGGGC
CGCAGACCGCCGTGGTGGTGGGGCCGGCGGGGGCCGAGATCTATACCGACGAGCATGCGCGGGTGAAGGT
GCAGTTCTTCTGGGACCGCAAGGGCCGGCGCGACGCGCATTCCAGTTGCTTCGTCCGCGTCAGCCAGACC
TGGGCCGGGGCGGGCTGGGGCTTCATCCAGATCCCCCGCATCGGGCAGGAGGTGATCGTCGATTTCCTGG
ACGGCGATGCCGACCGGCCCATCGTCACCGGCCGGGTCTACAATGCCGAGCAGGTGCCGCCCTATGGCCT
GCCCGGCAATGCCACGCAATCGGGCTGGAAATCCAACAGCTCGCCCGGCGGCGGCGGCTGGAACGAGCTG
CGCTTCGAGGACAAGGCCGGCGCCGAGGAGGTGTATTTCCAGGCGCAGAAGGACCATAACGAGCTGATCA
AGAACGACGAGACCCGCCGCATCGGCCATGACTGGATCGAGGATGTCGGCAACGACGCCACCCAATCCAT
CGGCAACGACCGCCGCGAAAGCGTGGGCCACGACAAGTTCACCACCATCGACGCGAACCGCCAGGTCTCG
ATCGGGGTGGACGATACGGAAAAGGTCGGCGGCCATCGCAGCCTGGACGTGGGCGCCACCGAGACGATCC
ATGTGGCCGCCAGTTCCACCGAGGCCATCGACGGTGCGCATAGCCAGACCGTCGGCGGCGTGCAGACCAT
CACCGTCAAGGCGGCGCGGGTGGACAGCGTGGCCGCGACCGAGACGCGCAATGTCGGCGCGGCGCAGACC
AATACCATCGTCGGCGCGCGCGCCGTGACGGTGCTGGCCGGGCAGAACCATGCGATCACCTCGGACGACG
GCTGGAAGGTGGGCGGCAACCGCTCGACCAACGTGGCGGGGAACGAAACCGTGGAGGTCGCCGGCAACCG
CAGCCACAAGGCGGGCGGCAACCGGGTCGAGAAGATCAGCGGCGATTCGACGCTGGACGTCGCCGGCAAG
CGAGGCACCACGGTCGGCGCGGACGAGTTGCACAAGGTCGGCGGCAAGATGGCCCTGGACGTGGGCGCGG
CGCTGGCCATCGTGGCGGCGGATTCGATCTCGCTGACCTGCGGCTCGGCCGCCATCGTGCTGAAAAAGGA
CGGCACCATCACCATCGAGGGCAAGGACATCATGATCAAGGGCTCGGGCAAGATCGACGTGAAGGCGTCG
GGCGAAACCTCGGTCAAGGGCTCCAAGGTCAACCTGAACTGA